KEGG   Geobacter metallireducens: Gmet_0325Help
Entry
Gmet_0325         CDS       T00295                                 

Gene name
cbcS-2
Definition
(GenBank) menaquinol oxidoreductase complex Cbc4, cytochrome c subunit
Organism
gme  Geobacter metallireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Paired_CXXCH_1 Cytochrom_c3_2 Cytochrome_C7 Cytochrome_C554 DZR Cytochrom_NNT Ribosomal_S27e DnaJ_CXXCXGXG
Motif
Other DBs
NCBI-ProteinID: ABB30568
UniProt: Q39YV6
Position
361826..362371
Genome map
AA seq 181 aa AA seqDB search
MGNHVWRPLYIAVALIALVLVARTFLVPKDFGVHERGYMYGWHRKGNEAEWKAVTVKYRT
AAYCKECHADKAESLARTPHGIISCENCHGPALNHPEDPPTLTIDRSRKLCLRCHAALIT
PTSGRASIAGINPETHNPEAECVLCHDPHNPVTREAHAKRDEEAGMLGASERGSEAYPLV
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggggaatcacgtctggcggccgctctatatcgccgtggccctgatcgcactggtcctc
gttgccagaacgttcctggtgccgaaagacttcggcgtccacgagcgagggtacatgtac
ggctggcaccgcaagggaaatgaggccgagtggaaggccgtgaccgtgaagtaccggacg
gccgcgtactgcaaggaatgccatgccgacaaggcggagagcctggcccgcaccccccac
gggatcatctcctgcgagaactgccacgggccggcgctgaaccatcccgaggacccgccc
accctcaccatcgaccggagccgcaagctctgcctccgctgccatgcagccctcatcacc
cccaccagcggcagggcctccatcgccggcatcaaccccgagacccacaaccccgaggcg
gaatgcgtcctgtgccatgatccccacaacccggtcacaagggaggctcatgcaaaacgt
gatgaggaggctgggatgctaggcgcaagcgagcgaggaagcgaggcgtacccgttggta
cgttga

DBGET integrated database retrieval system