KEGG   Geobacter metallireducens: Gmet_1089Help
Entry
Gmet_1089         CDS       T00295                                 

Definition
(GenBank) sodium/proton antiporter family protein
  KO
K03313  Na+:H+ antiporter, NhaA family
Organism
gme  Geobacter metallireducens
Brite
KEGG Orthology (KO) [BR:gme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gme02000]
    Gmet_1089
Transporters [BR:gme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Gmet_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiport_1 Tom6
Motif
Other DBs
NCBI-ProteinID: ABB31329
UniProt: Q39WP5
Position
complement(1212839..1213987)
Genome map
AA seq 382 aa AA seqDB search
MRKPINLLREFSVPLIAGVITALAWANLDPRGYDALIHQPSFGGVSLHFLVNELFMVLFF
GIAAAEITQSCLPGGDLNPPRKAVNPLLATLGGVIGPVLVYLSLNAVIGDPTLTKGWGIP
TATDIALAWLVARLVFGAGHPAVSFLLLLAVADDAIGLAIIAVFYPDPVHPTEPMWLFLT
VAGIVAAYILRGARAKSYWPYVLVGGGLSWTGLFKAHLHPALALVFIIPFLPHPPRESAH
LFEENPRDTSPLARFEHDWKIVVDFGLFLFGLANAGVRFSSVGTATWLVLTALLVGKTAG
ILTMGSLGKALGFPLPDRVGFKELALTGLVAGMGLTVALFVAGVAFVDPDIEGAAKMGAL
LSGGVLPVAVALGRILKVRRIP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgatcaatctactgagggagttctccgtccccctcatcgccggagtcata
acagccctcgcttgggcaaacctcgatccccgggggtatgatgcccttatccatcagcct
tctttcgggggggtcagcctccatttcctggtcaatgaactcttcatggtgctctttttc
gggatcgcagccgccgagatcacccagagctgccttcccggcggggacctgaacccgccc
cgcaaggccgtcaaccctctgctggcgaccctcggcggcgtcatcggcccagtgctcgtc
tacctgagtctcaatgccgtcatcggtgacccgaccctgaccaaggggtggggaatcccc
accgcaaccgacattgccctggcctggctcgtggcgcggctggtctttggcgccggccac
ccggcggtatcgttcctcctgctcctggccgtggctgacgacgccatcgggcttgccatc
atcgccgtcttctaccccgatccagtccaccccaccgagccgatgtggcttttcctgacg
gtggccggcatcgtggccgcctacatcctgcggggcgccagggcgaagagctactggccc
tatgtacttgtggggggagggctctcctggaccggcctgttcaaggcccacctccacccg
gccctggccctcgtcttcatcatccccttcctcccccatcctccgcgggaatcggcgcac
ctgttcgaggaaaatccccgcgacacctcccccctcgcccgtttcgagcacgactggaag
atcgtcgtcgacttcggcctcttcctcttcggcctcgccaacgcgggagtccgcttctcc
tcagtgggaacggccacctggctcgtgctgacagcgctcctggtcggcaagacggcaggc
atcttaaccatgggctcactgggaaaggccctcggcttccccctcccggacagggttggg
ttcaaggaactggcgttgacggggctggtggccggcatggggctcaccgtagccctcttc
gtggcgggggtcgcctttgtggatcccgacatcgagggtgcggccaagatgggggcgctc
ctctcggggggagtactcccggtggccgtggcgctcggcagaatcctgaaggtacggaga
atcccctga

DBGET integrated database retrieval system