KEGG   Geobacter metallireducens: Gmet_1104Help
Entry
Gmet_1104         CDS       T00295                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
gme  Geobacter metallireducens
Pathway
gme00051  Fructose and mannose metabolism
gme00520  Amino sugar and nucleotide sugar metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Gmet_1104
   00520 Amino sugar and nucleotide sugar metabolism
    Gmet_1104
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Gmet_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABB31344
UniProt: Q39WN0
Position
1227267..1228340
Genome map
AA seq 357 aa AA seqDB search
MYVVILAGGSGTRFWPLSRKLHPKQLMSVFGGKSMLQRTAERVLPLNPKRILVITNHLQA
EETRRQLEYLRGVRIEVIEEPLGRNTAPAICLAATLIARHDPEAVMAVLPADHFIRDEDA
FCATIQKGREAALNGYLVTLGITPDRPETGYGYIEAETSLRGDGPYPVKRFVEKPDRERA
LEFLAAGTFFWNSGMFLWRADVILGQMAAHMPELAQAFAGITFSPDIWEPADLAPQIEAV
YAMVKGESIDYGVMEKADSVAMIPASFGWSDVGSWSALPEVMEPDAAGNVVIGAPETVIA
DAAGCILRGEKLMALVGVRDLVVVDTPDALLVCAKDRAQDVKKVVEELERRGLRRCL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtcgtcatcctcgccggcggctccggcacccgtttctggcccctgtcccgcaaa
ctccatcccaagcaactcatgtcggtcttcggcggcaagtcgatgctccagcgaaccgcg
gaacgggttctcccccttaaccccaagcgaatactcgtgatcaccaaccacctccaggcc
gaggaaacccggcgccagctggagtatctgcggggcgtccggatcgaggtgatcgaggaa
cccctggggcgcaacacggcccccgccatctgcctcgccgccaccctcattgcccgccac
gaccccgaagcggtgatggcggtgctccccgctgaccatttcatccgtgacgaggatgca
ttctgtgccaccatccagaaggggagggaggcggccctgaacggctacctggtcaccctg
ggaatcacccctgaccgccccgagaccggttacggctacatcgaggccgagacatcgctg
cggggtgacgggccctacccggtaaagaggttcgtggaaaagcccgaccgcgagagggcc
ctggagttccttgccgccggcaccttcttctggaacagcggcatgttcctctggcgtgcc
gacgtgatccttggccagatggcagcccatatgccggaactggctcaggcctttgccggc
atcaccttttcccccgacatctgggaaccggccgacctggccccccagatcgaggcggtt
tacgccatggtcaaaggggagtccatcgactatggcgtcatggagaaggccgatagtgtg
gccatgatcccggcttccttcgggtggagcgacgtggggagctggagcgcgctccccgag
gtgatggagcccgacgcggccggcaacgtggtcatcggcgcgccggaaacggtcattgcc
gatgccgccggctgcatcctccgtggcgagaagctcatggcactggtcggggttcgggat
ctcgtggtggtcgatacccccgacgccctcctggtctgcgccaaggacagggcccaggac
gtgaagaaagtggtggaggagctggagcggcgcggcctgaggcgctgcctctga

DBGET integrated database retrieval system