KEGG   Geobacter metallireducens: Gmet_2007Help
Entry
Gmet_2007         CDS       T00295                                 

Definition
(GenBank) adenylyltransferase, putative
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
gme  Geobacter metallireducens
Pathway
gme00360  Phenylalanine metabolism
gme01100  Metabolic pathways
gme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Gmet_2007
Enzymes [BR:gme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Gmet_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ABB32236
UniProt: Q39U38
Position
complement(2245505..2246968)
Genome map
AA seq 487 aa AA seqDB search
MQVYPLIMNKLVMPAASRFTDLKIWDEYKVMLKSERLSLEQLRQMQLTKLQTIVRHAYEN
VPFYRQRFDSIGLHPEDIKSIEDIERIPPTTKDDIMANFPEGITAGGMDRNRWKYVASSG
TTRKIMGIHDFRKSTLNWAAGIRAHRLAGNHRMGMKWMEIPPHMCTTICGINDGPKGEKL
STKKLVSLVKEGDFGGAGRHVYEGLYSMRHDLYKRVTLPSFGPEGTNIPESDIVSYLDSI
RSYQPHLLEGLPLYLYTFAKYILDKGISAPRVGVIKPFGGSLTPYMKQIIATAFGCEVYD
TYGCSELGFMAADCPKHEGVHLFMDLYHVEVRHGDRAAAPGELGKFYVTDLENRAMPWIR
YEIGDVGRYFEDDHGCGRRGIRLEVEGRVQDTLVNSQGRFFTSDEVFDFFHRREEIDNFQ
LTEKSAGRYELLCVPVEGKEVDREGIARDFREFFDTEANVKAYAVKTIKAEDGGKFRFIK
AKGHDRL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtataccctctgatcatgaacaagctcgtcatgccggccgcatcgcggtttacg
gacctcaaaatatgggacgagtacaaggtgatgctgaaatcggaacggctgagccttgaa
cagctgcgccagatgcagttgacgaagcttcagacgattgtccgccatgcctacgagaat
gtcccgttttaccggcagcggttcgattcgatcgggctgcatcccgaagatatcaagtcc
attgaggacatcgagcggattccgccgaccaccaaggacgacatcatggccaacttcccc
gaggggattacggccggggggatggaccgcaaccgctggaagtatgtggccagttcaggc
acgacgcgcaagatcatgggtatccacgattttcgcaagtcgaccctcaactgggccgcg
gggatcagggcccaccgtcttgccggcaaccacaggatggggatgaagtggatggagatt
cctcctcacatgtgcaccaccatctgcgggatcaatgacgggcccaagggtgagaaactc
tccacgaagaagctggtttcactggttaaggaaggtgatttcggcggtgcggggaggcat
gtgtacgaggggctctacagcatgcgtcatgacctgtacaagcgggtgacgctcccttcc
ttcggtccggaggggaccaatatcccggaaagcgacattgtttcctatctggattctatc
cggagctatcagccacacctgctggaggggcttcctctctatttgtacacgtttgccaag
tacattctcgacaaggggatttccgctccccgcgtcggtgtcatcaagcccttcggcggt
tcgttgaccccgtacatgaaacagattatcgccacggcgttcgggtgcgaggtgtatgac
acttacggctgcagcgagttgggtttcatggccgctgattgtccgaagcacgaaggggtc
catctcttcatggatctctaccatgtggaggtccgtcatggtgatcgggccgcagcaccg
ggggaactgggcaagttctacgtgactgatctggaaaacagggccatgccgtggatcaga
tacgagatcggggatgttggccgctacttcgaggatgaccacggatgcggccggagaggg
atccggctggaagtggagggaagggtgcaggacaccttggtcaactcccaggggaggttt
ttcaccagcgacgaggtgttcgattttttccatcggcgtgaagagatcgacaacttccag
ctaacggagaaatcggccggccggtatgagctgctgtgtgttccggttgaaggtaaagag
gtcgaccgggaggggattgccagggatttccgggaattcttcgatactgaggcgaatgta
aaggcatacgcggtaaagaccatcaaggccgaggatggcgggaagttccggtttatcaag
gcaaaggggcacgacaggctgtaa

DBGET integrated database retrieval system