KEGG   Geobacter metallireducens: Gmet_2074Help
Entry
Gmet_2074         CDS       T00295                                 

Gene name
bamN
Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gme  Geobacter metallireducens
Pathway
gme00071  Fatty acid degradation
gme00072  Synthesis and degradation of ketone bodies
gme00280  Valine, leucine and isoleucine degradation
gme00310  Lysine degradation
gme00362  Benzoate degradation
gme00380  Tryptophan metabolism
gme00620  Pyruvate metabolism
gme00630  Glyoxylate and dicarboxylate metabolism
gme00640  Propanoate metabolism
gme00650  Butanoate metabolism
gme00900  Terpenoid backbone biosynthesis
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01200  Carbon metabolism
gme01212  Fatty acid metabolism
gme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gmet_2074 (bamN)
   00630 Glyoxylate and dicarboxylate metabolism
    Gmet_2074 (bamN)
   00640 Propanoate metabolism
    Gmet_2074 (bamN)
   00650 Butanoate metabolism
    Gmet_2074 (bamN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gmet_2074 (bamN)
   00072 Synthesis and degradation of ketone bodies
    Gmet_2074 (bamN)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gmet_2074 (bamN)
   00310 Lysine degradation
    Gmet_2074 (bamN)
   00380 Tryptophan metabolism
    Gmet_2074 (bamN)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gmet_2074 (bamN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gmet_2074 (bamN)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gmet_2074 (bamN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gme04147]
    Gmet_2074 (bamN)
Enzymes [BR:gme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gmet_2074 (bamN)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gmet_2074 (bamN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABB32303
UniProt: Q39TX1
Position
complement(2333226..2334401)
Genome map
AA seq 391 aa AA seqDB search
MSDVYVIESLRTPLGSFGGELSDVEAPRLAATVIRELLQRSGLPAEGVDEVIVGQVLAGG
TGQAPARQAMRYAELPDSIPAMTINKVCGSGLKALMLGADAIRLGDVGVVIAGGMENMSL
APYVLSKGRNGYRLGNGELIDLLVNDGLLDPYSGNHMGVIAEATTEKHGISRADQDAFAF
RSYQKAQTAVKEGIFRDEIVPVVKKGRKGDVTVSDDEEPFKVDFTKLMGLKSAFKKEGTI
TAGNASTINDGAALTLLASGEAVKKYGLKPRARLVAYASNSLHPDQFTEAPVGAIEKACA
KAGLKLEDIDLFEINEAFAAVTMLAIKQLGLDPEKVNVNGGAVAIGHPLGASGGRLAATL
VRELHRRQARFGLATLCIGGGEAVAAIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtttatgtaatcgaatcgctgcgcactcccctcggctccttcgggggggag
ttgtccgacgtggaggcgccgcgcctggccgccaccgtcatccgggaactgctccagcgt
tccggccttcctgccgagggcgtcgacgaggtgattgtcggtcaggttctcgcgggcggg
acgggacaggccccggcccggcaggccatgcgctacgccgaactccccgacagcattccc
gccatgaccatcaacaaggtctgcggcagcggcctcaaggcgctcatgctcggcgccgat
gccatccgcctcggtgatgtcggcgtggtgatcgccggcggcatggagaacatgtccctg
gccccctatgtactgagcaaggggcgtaacggctatcgtctgggtaacggcgagctgatc
gacctcctggtaaatgacggcctcctggatccctacagcggcaatcacatgggggtaatc
gccgaggccaccacggaaaagcacggcatctcccgggcagaccaggatgcctttgccttc
cgctcctaccagaaagcgcagacagcggttaaggaagggatattccgggatgagatcgtc
ccggtggtcaaaaaggggcgcaagggggacgtgaccgtcagcgacgacgaagagccattc
aaggtggacttcaccaaactcatggggttgaagagcgccttcaagaaggaagggaccatc
accgccggcaacgcctcaaccatcaatgatggtgcggccctgacccttctggccagtgga
gaggcggtgaaaaaatacggtctcaagcccagggcccgactggtcgcctatgcctccaac
agcttgcatcccgaccaattcaccgaggcgccggtgggagccatcgaaaaggcctgcgcc
aaggccggtctgaagctcgaagacattgatctgttcgagatcaacgaggcctttgccgcc
gtgaccatgcttgccatcaagcaactggggctcgatccggaaaaggtcaacgtcaacggc
ggggcagtggccattggccatcccctgggggcaagcggcggacgtcttgccgctaccctg
gttcgggaactgcaccggcgccaggcccgcttcgggctcgcaaccctctgcattgggggt
ggtgaagcagtggcggcaatcttcgagcgggtctga

DBGET integrated database retrieval system