KEGG   Geobacter metallireducens: Gmet_2196Help
Entry
Gmet_2196         CDS       T00295                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gme  Geobacter metallireducens
Pathway
gme00071  Fatty acid degradation
gme00280  Valine, leucine and isoleucine degradation
gme00281  Geraniol degradation
gme00310  Lysine degradation
gme00362  Benzoate degradation
gme00380  Tryptophan metabolism
gme00410  beta-Alanine metabolism
gme00640  Propanoate metabolism
gme00650  Butanoate metabolism
gme00903  Limonene and pinene degradation
gme00930  Caprolactam degradation
gme01040  Biosynthesis of unsaturated fatty acids
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01200  Carbon metabolism
gme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gmet_2196
   00650 Butanoate metabolism
    Gmet_2196
  Lipid metabolism
   00071 Fatty acid degradation
    Gmet_2196
   01040 Biosynthesis of unsaturated fatty acids
    Gmet_2196
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gmet_2196
   00310 Lysine degradation
    Gmet_2196
   00380 Tryptophan metabolism
    Gmet_2196
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gmet_2196
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gmet_2196
   00281 Geraniol degradation
    Gmet_2196
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gmet_2196
   00930 Caprolactam degradation
    Gmet_2196
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Gmet_2196
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Gmet_2196
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Gmet_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABB32423
UniProt: Q39TK1
Position
complement(2483530..2484369)
Genome map
AA seq 279 aa AA seqDB search
MSAYRYERDGEGIVTVTINPAGQPASIMDEGTAGELLDRLERDTISGVIITIDQASPATA
CTVSENSLSARQQVFNRLSAYKSMLRRLETLGKPVVAAINGPTQGRDYELCLAAHHRIAV
NDLAIAIGLPDVAAGLIPCNGGVARLVRLIGLEKGLPLLMAGTKLAPEKAKETGLIDQLA
ASSGELQSMARDWIAANPAAGQPWDQKGYKMPGGTPSSPNIAQQIFVAPAILRKKCADGQ
PAQESILAVAVEGAQVDLESALRIESRYFTDLLFRTAAG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcatacagatatgaaagggatggagagggtatcgtaaccgttaccatcaatccc
gcaggccagccggccagcatcatggatgaaggaacggcgggagagcttctcgatcgcctt
gaacgcgataccatcagtggtgtcattatcaccattgatcaggcatcacccgctaccgcc
tgcactgtcagcgaaaacagcctttcggcacgtcagcaggtttttaaccgcctcagtgct
tacaaaagcatgctgcggcgtcttgaaactcttggcaaaccggtcgttgcagccatcaat
ggtccgactcagggaagagattacgaactttgcctggccgcccatcaccgcatagcggtc
aacgatcttgccatcgcgatcggcctgccggacgtagcggcaggtctgattccctgcaac
ggtggagtagcgcgcttggtccgcctgattgggctcgaaaaggggttgccgctcctcatg
gcaggaacaaaacttgccccggaaaaggcgaaagagactggtctgattgaccaactagct
gccagcagtggcgaactccaatccatggcacgagactggatcgctgccaatcccgctgcc
ggtcagccctgggaccagaaaggatataagatgccgggggggacaccttccagccccaat
atagcgcaacagatctttgttgcaccggccatcctgcggaaaaaatgcgctgacgggcaa
ccggcacaggaatcgatactggcggtggcggtcgaaggcgcccaagtcgacctggaatcg
gctctgcgcatcgaatcccgctattttacggatctgctgtttcgaacagctgccggttaa

DBGET integrated database retrieval system