KEGG   Gemella morbillorum: NCTC11323_00917Help
Entry
NCTC11323_00917   CDS       T05494                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
gmo  Gemella morbillorum
Pathway
gmo00430  Taurine and hypotaurine metabolism
gmo00620  Pyruvate metabolism
gmo00640  Propanoate metabolism
gmo00680  Methane metabolism
gmo01100  Metabolic pathways
gmo01120  Microbial metabolism in diverse environments
gmo01200  Carbon metabolism
Module
gmo_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:gmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC11323_00917 (ackA)
   00640 Propanoate metabolism
    NCTC11323_00917 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    NCTC11323_00917 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NCTC11323_00917 (ackA)
Enzymes [BR:gmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NCTC11323_00917 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: SQH55452
UniProt: A0A2X4R1P9
Position
1:complement(911868..913052)
Genome map
AA seq 394 aa AA seqDB search
MTKILAINSGSSSLKFQLFEMPEEKVITKGLVERIGIENSMFTIEYNGEKIKETLDIPNH
DVAIEMLLEKLTKLGIVNDVKEIEGVGHRVVHGGEFYDSSVLVTDEELAKVDSIEDLAPL
HNPANIKGARSFQKELPGVPNVLTFDTAFHQSMPKATYMYAVPREFYEKYGVRKYGAHGT
SHRYVSEKVAELLGKDPKELKTISCHIGNGASICAVKYGKSFDTSMGFTPLSGLVMGTRT
GDIDPATIPYIAKKTGLSLEEIVRIFNFESGLKGISALSSDLRDIEDVRDTNPYAAEAVE
VYINRIKEYIGAYAAAMNGVDAIVFTAGVGENATWVREEVLEGLTFLGVEVDKEKNNVRG
KVAEISTENSKVKAFVIPTDEEVMIARDTYNLSK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatacttgctattaattcaggaagttcatcattaaaatttcaattattcgaa
atgcctgaagaaaaggttattactaaaggattagttgaaagaataggaattgaaaatagt
atgtttactattgaatacaatggtgaaaaaattaaagaaacactagatattcctaatcat
gatgtagcaatagaaatgttacttgaaaaattaactaaactaggaatagttaatgatgtt
aaagaaattgaaggagttggacatcgtgtagttcatggtggggaattttatgattcatca
gtattagttacagatgaagaattagcaaaagttgattctatagaggatttagcgccatta
cataatccagctaatataaaaggagcacgttcattccaaaaagaactaccaggagtacca
aacgtattaacatttgatacagcattccaccaaagtatgccaaaagcaacatatatgtat
gcagttcctcgtgaattttacgaaaaatacggtgttcgtaaatatggtgcacacggaaca
agtcacagatacgttagtgagaaggtggcagaattattaggaaaagaccctaaagaactt
aaaactatctcatgccatatcggtaatggagcttcaatatgtgctgttaaatatggaaaa
tcatttgatacatcaatgggattcacacctctttcagggcttgtaatgggaactagaaca
ggggatattgatccagcaactataccatatattgctaaaaaaacgggattatctttagaa
gaaatcgttcgtattttcaactttgaatcaggacttaaaggtatttcagctttatcatct
gatttacgtgatatagaagatgtaagagatacaaatccatatgcagcagaagctgttgag
gtttatattaatagaattaaagaatatatcggagcttatgcagcagcaatgaatggagta
gatgccattgtattcacagcaggtgttggagaaaacgcaacgtgggtacgtgaagaagta
ttagaaggtctaacattcttaggagtagaagtagataaagagaaaaacaacgttcgaggc
aaagttgcagaaatttctacagaaaattctaaagtaaaagcatttgttattccgactgat
gaagaggttatgatcgctcgcgatacatataacttatctaaataa

DBGET integrated database retrieval system