KEGG   Gemella morbillorum: NCTC11323_01406Help
Entry
NCTC11323_01406   CDS       T05494                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
gmo  Gemella morbillorum
Pathway
gmo00051  Fructose and mannose metabolism
gmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCTC11323_01406 (mtlD)
Enzymes [BR:gmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     NCTC11323_01406 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh TrkA_N UDPG_MGDP_dh_N CDI 3HCDH_N EcsC DpnI_C
Motif
Other DBs
NCBI-ProteinID: SQH55922
UniProt: A0A2X4R2X2
Position
1:complement(1420064..1421212)
Genome map
AA seq 382 aa AA seqDB search
MKNLHFGAGNIGRGFIGELLNKSGYHITFVDINKDVVNGLKCRDTYTIKILDENIEEIEL
NNFDALNIAEEKEELYKAIGEVELVTTSIGPNVLPIIAKDIAEGLKLKVANNNTKLLDII
ACENMIAGSDFLKQEIYKQLTEEEQKFVEACVGFPNSAVDRIVPAQKHEDVLLVEVEKFC
EWVIEEDKIKVEKNKNIENVHYVKDLNPFIERKLFTVNTGHAALSYIANYLGIELVSDGA
KHTEVRKDFIAVLEETSALLEKKWGFSKEEMTAYRNKTIKRFENPRIVDNVSRICRTPIR
KLGYNERFIKPIRETEELGLPNSALLKACSYILTFKSIEDEQSLKLAELIVEKGVVETLR
EVTELTDEVLLNKIKDSYEKLI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttacattttggagcagggaatataggacgtggttttataggggaactactt
aataaatcgggatatcatataacatttgtagatattaataaagatgtagtcaatggttta
aaatgccgtgacacatatactataaaaatattagatgagaatatagaagaaatagagcta
aataattttgatgctttaaatatagcggaggaaaaagaagaactttacaaagctatagga
gaggtcgaactcgttactacatctataggaccaaatgtgctacctataatagcaaaagat
attgcagaaggtttgaaattaaaagttgcaaataataacacaaaattattagatattatt
gcttgtgaaaatatgatagcaggatcagattttctaaaacaagaaatttataagcagctt
acagaagaagaacaaaaatttgtagaggcatgtgtaggttttccgaattcagcggtagat
agaatagttccagcccaaaagcatgaggatgtactattagtagaagtagagaagttttgt
gaatgggttatagaagaagataagataaaagtagaaaaaaataaaaatatagaaaatgta
cactacgtaaaagatttaaatccgtttattgaaagaaaattattcacagtaaatacgggg
catgccgctcttagttacatagctaactatttaggtatagagttggtatctgatggagcc
aagcatacagaagttagaaaagactttattgctgtcttagaagaaactagtgcattgctt
gagaaaaaatggggattttctaaagaggagatgacagcgtatagaaataaaactattaaa
cgttttgagaatcctcgtatagtagacaatgtttctagaatttgtcgcacacctattaga
aaattaggttataatgaaagatttattaaacctattagggaaactgaggagttaggattg
cctaattcagctttattaaaagcatgttcatatatactgacatttaaatcaattgaagat
gaacaatctctaaagcttgcggagttaatcgtagaaaaaggtgtagttgaaacactacgt
gaagtaacagaattaactgatgaagtattgttaaataaaataaaagatagttacgagaag
ttaatataa

DBGET integrated database retrieval system