KEGG   Gemella morbillorum: NCTC11323_01480Help
Entry
NCTC11323_01480   CDS       T05494                                 

Gene name
aldA_2
Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
gmo  Gemella morbillorum
Pathway
gmo00620  Pyruvate metabolism
gmo00630  Glyoxylate and dicarboxylate metabolism
gmo01100  Metabolic pathways
gmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC11323_01480 (aldA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC11323_01480 (aldA_2)
Enzymes [BR:gmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     NCTC11323_01480 (aldA_2)
    1.2.1.22  lactaldehyde dehydrogenase
     NCTC11323_01480 (aldA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA ILVD_EDD DnaB_bind
Motif
Other DBs
NCBI-ProteinID: SQH55985
UniProt: A0A2X4N8X4
Position
1:1497813..1499264
Genome map
AA seq 483 aa AA seqDB search
MTEVKILKMFINGEFEEHLNHEHLKVLNPATEEVIAKIPSGNFKDVDRAINAADAAQKSW
EKLPAVERGEYLRKIAKKIREREPEITQTIVNEGGKTFELAKVEVLFTADYMDYMAEWAR
RYEGEIIQSDRKDEHILLFKRPYGVTTGILPWNFPFFLIARKAAPALLTGNTIVLKPSQL
TPINAHIFAEICQEVGLPKGVLNIIHGRGSVVGNRLASHPKVGLVSLTGSLAAGQEVMKA
AADNITNVSLELGGKAPAIVFEDADLELAAKAIVASRVINSGQVCNCAERVYVHESIKEK
FEEALFNELDKVKFGDPNKERGLDYGPLIEKRALKQVIEKVGYAVKQGATLAYGGEVDKE
QVGYFYGPTVLTDVTNDMTIMKEEIFGPVIPVATFKTLDEVIDYANDSEYGLTSSVYTKN
LNTAFKAINGLKFGETYVNRENFEAMQGFHAGRRKSGIGGADGKHGLEEYLTTQVVYLQL
DNE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagttaaaattttaaaaatgttcataaacggggagtttgaagaacatcttaat
cacgaacatcttaaagtattaaatccagctacggaggaagtaatcgctaagattccatct
ggaaatttcaaagatgttgaccgtgctatcaatgccgctgatgctgcacaaaaatcatgg
gagaaacttccagccgtagagcgcggagaatatttacgtaaaattgctaaaaaaattcgt
gagcgcgagccggaaattacgcaaactatcgttaacgaaggtggaaaaacttttgaacta
gcaaaagtagaagtgcttttcacagctgattatatggattacatggcagaatgggctcgt
agatacgagggagaaattattcaaagcgacagaaaagatgagcatattcttttattcaaa
cgtccttatggtgttactacagggattctaccatggaacttcccattcttcttaatcgca
agaaaagctgcacctgcattacttactggtaatacaatagttcttaaacctagtcaactt
acaccaattaacgctcatatcttcgctgaaatttgtcaagaagttggtttaccaaaaggt
gtactaaacatcattcacggtcgtggatcagtagtaggtaacagattggcatctcaccct
aaagttggcttagtaagtttaacaggtagtcttgctgcaggacaagaagttatgaaagca
gctgctgataacatcactaatgtttcattagaacttggaggaaaagctccagctatagtt
tttgaagatgcagatttagaacttgcagcaaaagcaattgttgcttctcgtgttatcaac
tcaggtcaagtatgtaactgtgcagaaagagtatacgttcatgaaagtataaaagaaaaa
ttcgaagaagctttattcaacgaacttgataaagttaaatttggagatccgaataaagaa
cgtggtttggattacggtccacttattgaaaaacgtgcattaaaacaagtgatcgaaaaa
gttggttacgctgttaaacaaggtgctacacttgcttatggtggagaagtagacaaagaa
caagtaggatacttctatggacctactgttttaactgatgtaacaaatgacatgactatt
atgaaagaagaaatattcggaccagtaattcctgttgcgacatttaaaactttagatgaa
gtaatagattacgctaatgattctgaatatggtctaacttcttcagtttatactaaaaat
cttaacactgcatttaaagctattaatggcttaaaatttggtgaaacttatgttaaccgt
gaaaactttgaagcaatgcaaggattccatgcaggacgtcgaaaatcaggaattggtggt
gctgatggtaaacatggtttagaagaatacttaactactcaagtagtttatcttcaatta
gataatgaataa

DBGET integrated database retrieval system