KEGG   Glycine max (soybean): 100037472Help
Entry
100037472         CDS       T01710                                 

Gene name
PDIS-2
Definition
(RefSeq) protein disulfide isomerase-like protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100037472 (PDIS-2)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100037472 (PDIS-2)
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100037472 (PDIS-2)
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100037472 (PDIS-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_7 Thioredoxin_8 Thioredoxin_6 Redoxin TraF HyaE Thioredoxin_9 Thioredoxin_3 Trimer_CC
Motif
Other DBs
NCBI-GeneID: 100037472
NCBI-ProteinID: NP_001236313
UniProt: E3W9C1
Position
19
AA seq 362 aa AA seqDB search
MWSSKTTMMLAIAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCK
RLAPEYEQLGASFKKTKSVLIAKVDCDEHKSVCGKYGVSGYPTIQWFPKGSLEPKKYEGA
RTAEALAAFVNIEAGTNVKIASVASSVVVLSPNNFDEVVFDETKDVLVEFYAPWCGHCKA
LAPIYEKVAAAFNLDKDVVIANVDADKYKDLAEKYGVSGYPTLKFFPKSNKAGENYDGGR
DLDDFVAFINEKCGTYRDGKGQLTSKAGIIASLDDLVKEFVSADSNEKKAVYSRLEEEVK
KLKGSSARHGDLYLKLAKKGMEKGADYAKNEIQRLERMLEKSVSPAKADEFTLKKNILSI
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctccaaaacgacgatgatgctggccattgcagccattgctctgatgatgttt
ctctcatcggcttcagccgacgacgtcgttgcactcacagaggaaaccttcgaaaacgag
gttggcaaggatcgcgccgctctcgttgagttttacgctccctggtgtggacactgtaaa
aggcttgccccggagtacgaacagctcggagcgagttttaagaaaacgaagtccgttttg
attgccaaggtggactgtgatgaacataaaagcgtttgcggtaaatatggggtatctggt
taccctaccattcaatggtttcctaagggatctctagaacctaaaaagtatgaaggtgca
cgtactgcagaagcccttgctgcgtttgtgaacattgaagcaggtacaaatgtgaagata
gcttctgttgcatccagtgtggtagttctctctccaaataactttgatgaggttgtcttc
gatgaaacaaaagatgttctggtggaattctatgcaccatggtgtggtcattgcaaggcc
cttgcccctatttatgaaaaagttgctgcagcatttaacctggataaagatgtagttata
gccaatgttgatgccgacaagtataaagatttggctgagaaatatggtgttagtggctat
cctacactgaagtttttcccaaagagcaacaaagctggtgaaaattatgacggtggccgt
gatttggatgattttgtagcattcatcaatgagaaatgtggtacctaccgtgatgggaag
gggcagcttacttctaaagctggtataatagcatctctggatgacttggtgaaggagttt
gtgagtgctgacagtaatgagaagaaggcagtatattcccggcttgaggaggaagttaag
aagcttaaaggttcttctgccagacatggcgacctttacttaaaacttgctaagaagggt
atggaaaagggtgcagactatgcaaagaatgaaattcaacgtcttgagcgcatgcttgag
aagtcagtcagcccagcaaaagcagatgaattcactctcaagaagaacatcttatctatc
tttgcttga

DBGET integrated database retrieval system