KEGG   Glycine max (soybean): 100127365
Entry
100127365         CDS       T01710                                 

Gene name
AT133
Definition
(RefSeq) malonyl-CoA:isoflavone 7-O-glucoside-6''-O-malonyltransferase
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00943  Isoflavonoid biosynthesis
gmx00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    100127365 (AT133)
   00943 Isoflavonoid biosynthesis
    100127365 (AT133)
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     100127365 (AT133)
SSDB
Motif
Pfam: Transferase Condensation
Other DBs
NCBI-GeneID: 100127365
NCBI-ProteinID: NP_001236819
UniProt: A7BID0
Position
19
AA seq 463 aa
MAESPTFKVHEVCSISPPQETPPTTLPFTLFDVLWLRFPPVERLFFYSFPNPTTTSFFDT
TVLPNLKHSLSLTLHHFPPLAGTITWPNHSPLPLITYTPGNTIPFTIAQSNADFNTLSSN
LSQVNHHLQNLIPHLTISHEEASVLALQLTLFPNQGFSIGITTHHAALDGKSSTLFIKSW
AHFCSQLNTSPEEPLSLPKHLIPSFDRSVIRDTLGIGEIYANSWMNFGGATNDRSLNVWD
SLGGSQTDLVKGLFELTPLDIKKLKKLAESKVVVGDNKKKIRVTSFTVTCAYLLSCAVKA
EQPNCERVPFIFSVDCRARLDPPIPGTYFGNSVVSLLVIAKREELLGEEAFFKSVLGISE
ELNRIEGDVLNGADRWMPKIQSVMSERPRLFSVAGSPRFEVYDVDFGWGRPKKVDVTSVD
KTGAFSLSETRDHSGGIQIGLALTKSQMEAFSTVFAQGLESLE
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcagagtcaccaaccttcaaagtccatgaagtctgctccatttcgccgccacaagaa
accccaccaacaactcttcccttcaccctcttcgacgtcctatggcttcggttcccccca
gtggagcgtctcttcttctattccttcccaaacccaacaacaacatcatttttcgacacc
accgttctcccaaatctcaaacactccctctccctcactctccaccacttccctcctctc
gccggcaccatcacatggcccaatcactcacccctccctctcataacctacactcccggc
aacaccatccccttcacaatcgcccaatccaacgcagatttcaacaccctctcttcaaac
ctctctcaagtcaaccaccacctccaaaacctaataccccacttaaccatttcccatgaa
gaagcttccgtgttagcacttcaactcaccctcttccccaaccaaggcttttcgattgga
atcacaacccaccacgctgcacttgatggaaagtcttcgactttgttcatcaaatcgtgg
gcgcatttttgttctcagcttaatacctccccagaagaaccgttatcactaccaaagcat
ctaataccctcgtttgatagatctgttataagagacactttggggatcggtgagatttac
gcgaactcatggatgaacttcggtggagccaccaatgaccgaagcttgaatgtgtgggat
tccctcggtggaagtcaaaccgatttggttaaagggttgttcgagttgacaccgttggat
atcaagaagctgaagaaattagcggagtctaaggttgttgtcggagacaacaagaagaag
attagggtgacatcgttcacggtcacgtgcgcttacttgttgtcatgcgcggtgaaagcg
gagcaacccaactgcgaaagagtgccttttattttcagcgtggactgtagggcgcgtttg
gatccaccaattccgggaacgtactttgggaacagcgtcgtgtctttgttggtgatagca
aagcgagaagagctattgggggaagaagcgttttttaaaagcgttttagggataagcgaa
gagttgaacaggatagagggtgacgtgttgaacggtgcggacaggtggatgccgaagatt
caatcggtgatgtcggagaggccgaggttgttctctgttgcggggtctccgaggtttgag
gtttacgatgttgactttgggtggggaaggcctaagaaagtggatgttacttccgttgat
aaaacgggtgcgttttcactttcggagactagggatcacagtggaggcattcaaattggg
ttggcgttgaccaagagtcaaatggaggcgttttctacggtttttgctcaagggcttgag
tccttggaataa

DBGET integrated database retrieval system