KEGG   Glycine max (soybean): 100127406Help
Entry
100127406         CDS       T01710                                 

Gene name
IPK1
Definition
(RefSeq) inositol pentakisphosphate 2-kinase
  KO
K10572  inositol-pentakisphosphate 2-kinase [EC:2.7.1.158]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00562  Inositol phosphate metabolism
gmx01100  Metabolic pathways
gmx04070  Phosphatidylinositol signaling system
Module
gmx_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100127406 (IPK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100127406 (IPK1)
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.158  inositol-pentakisphosphate 2-kinase
     100127406 (IPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins_P5_2-kin MCM_N
Motif
Other DBs
NCBI-GeneID: 100127406
NCBI-ProteinID: NP_001237433
UniProt: A7X641
Position
14
AA seq 456 aa AA seqDB search
MALTLKEEDAADWVYRGEGAVNLVLAYAGSSPSFIGKVVRIRKAPRNGSQSKSVSVRNSI
ALTPHERVLWKDVHQLISSSDKEIVGQLYVQHVMKPLLGSNSVDAGMHVLVTREFLELVE
KNVSGQRPAWRVEAARVDAHCDFGLLMSDHSLFAYGSQGSSLCLSVEIKPKCGFLPLSRF
ISEVNAIKRRITRFEMHQTLKLLQGEISQLSEYNPLDLFSGSKERILKAIKGLLTTPQNN
FRVFLNGSLILGGLGGVAKNTDVCIAKAFEDELKSIIRADDDLCTNNLSTLVTEALQKSG
VLDKLLKVQKLDNIDIEGVIHAYYNITSQQCMVCKELSEEQAKIYTPLHSASLDESLRIV
KDYLIATTAKDCSLMLCFRPRNEEDSGSVYDNVYLDSTEQSFDYKVYFIDLDLKRLSKVE
DYYELDKKIVNCYRQIIKMDQGRNEETGLKASNAAY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcattgactttgaaagaggaagacgcagctgactgggtttacagaggggaaggagca
gttaatcttgtgctcgcttacgctggatcctcaccttcttttattgggaaagtggtccgc
atacgtaaggctccaaggaatggatcgcagtcaaagagtgtgagtgtgaggaatagcata
gctttgactccacatgaacgtgttctctggaaagatgtgcatcaacttatctcctcttca
gacaaggaaatagttggtcaactatatgtgcagcatgttatgaagcctttgcttggttcc
aactctgttgatgctgggatgcacgtcctggtgaccagggaattccttgagttggttgag
aagaatgtttctggtcaacgtcctgcgtggcgagttgaagctgccagggttgatgcacat
tgtgattttggccttctcatgtcagatcattctctctttgcttatggcagtcaaggatct
agcctctgcttatctgttgagataaagcccaaatgcggatttcttcctctttcaagattc
atatctgaagtaaatgctatcaaaaggagaataacccgatttgaaatgcaccaaactctg
aaattgcttcaaggagagatatcgcaactaagtgagtacaatccacttgatctgttctct
ggatccaaggaaagaattctgaaagctattaaaggtctccttacaactcctcaaaacaat
tttcgtgtatttttgaatggctctctcatacttggaggactgggaggtgttgcaaaaaat
acagatgtttgtattgctaaagcatttgaagatgaacttaagtcaatcattcgagctgat
gatgatctatgtacaaataacttatctactcttgttactgaggctttgcaaaaatcagga
gtccttgataagctcctgaaggtgcagaagcttgataatattgacatagaaggggtcatc
catgcatattataacattacttctcaacagtgcatggtgtgtaaggaattgagtgaagaa
caggcaaaaatatatacccctttgcattcagcttcactggatgaaagtttgagaattgta
aaggactacctgatagcaacaactgcaaaagactgcagtttgatgttgtgttttagacca
aggaatgaggaggattctggatctgtgtacgataatgtatatctggactcaacggagcaa
tcctttgattataaggtgtattttatcgaccttgatttaaagcgcttaagtaaagtggaa
gactactatgaattagataagaagatagtgaactgctacagacaaatcatcaaaatggat
caaggaagaaatgaagagacaggcttgaaggcatctaatgctgcatattga

DBGET integrated database retrieval system