KEGG   Glycine max (soybean): 100137073Help
Entry
100137073         CDS       T01710                                 

Definition
(RefSeq) pyruvate orthophosphate dikinase regulatory protein
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100137073
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     100137073
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     100137073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 100137073
NCBI-ProteinID: NP_001236533
UniProt: A9QNE4
Position
20
AA seq 382 aa AA seqDB search
MPISQLCPNIHSVPQIVACTRNDKTGSKSVSGRPKVSPQLNRWSRARAVRFGQKLDRSSM
RTQLPEPNPPARPLPLPVDPDDAVNLDGADVTAVKSIYIVSDGTGWTAEHCVNAALGQFD
YCLVDRGCPVSTHLFSGIDDTEKLLEITKQAAKEGAFLVYTLADPSLASTAKQACKLWGV
PYTDVLGPITEAIASHLGVSPSGLPRGASGLPLSDDYFRRIEAVEFTIKQDDGACPQNLA
KADIVLTGVSRTGKTPLSIYLSQKGYKVANVPIVLGVGVPRTLFEVDPKKVFGLTINPLI
LQNIRRTRAKTMGLSSDGSSNYSEMNYVREELEFAGRLFAQSPLWPVIDVTGKAIEETAA
VVLRLYHDRKHKCIMPRISKRY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccaatttcgcagttatgtccaaatatccattccgttcctcaaatcgtagcgtgcacc
cgcaacgacaaaacgggatcgaaatccgtttcggggagacccaaggtgagccctcaactg
aaccgttggtccagagcccgagccgtacggttcggtcagaaattggaccggtccagtatg
cgaactcagctaccggaacccaaccctcctgcacgtccacttcctctcccggtggaccca
gacgacgccgtcaatttggacggcgcagatgtcacggccgtcaaatccatctatatagtc
tccgacggaaccggctggaccgccgaacactgcgttaacgccgctttgggtcagttcgat
tactgcttggtcgaccgtggctgccccgtcagtacccatttgttttctgggattgatgat
acggagaagttgttggagatcacaaagcaagcagcgaaggaaggtgctttccttgtgtat
actttagctgacccatcattggcttcaactgcaaagcaggcatgtaagttatggggtgtg
ccttacactgatgtattgggacccattacagaggccattgcttctcatttgggtgtttct
ccctctggccttcctcgtggggcttctggactccccctctccgatgattactttcgtagg
attgaagctgttgagtttaccatcaagcaagatgatggagcgtgtccccagaatctggcc
aaggctgacattgttctcaccggcgtttcacgcaccggcaagacccccttgtcaatttat
ctgtctcagaaggggtacaaggtggccaatgtgcccattgtcttgggcgtgggagtgcca
aggactctgttcgaggtggatccaaagaaagtttttggtttgactataaatcctcttatc
ttacagaatattagaagaacaagggctaaaactatgggattaagttctgatggtagcagt
aattactcggagatgaattatgttagggaggagcttgaatttgcgggaaggctctttgca
cagagccctctttggccagtcatcgatgtgactggaaaagccatagaagagactgcagca
gttgtattgaggctgtaccatgacaggaagcacaaatgcatcatgccaaggatctcaaaa
cgctattag

DBGET integrated database retrieval system