KEGG   Glycine max (soybean): 100194416Help
Entry
100194416         CDS       T01710                                 

Definition
(RefSeq) vestitone reductase
  KO
K13265  vestitone reductase [EC:1.1.1.348]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00943  Isoflavonoid biosynthesis
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    100194416
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.348  (3R)-2'-hydroxyisoflavanone reductase
     100194416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA KR adh_short Polysacc_synt_2 DUF1731
Motif
Other DBs
NCBI-GeneID: 100194416
NCBI-ProteinID: NP_001236520
UniProt: B5LZ63
Position
18
AA seq 327 aa AA seqDB search
MAEGKGRVCVTGGTGFLGSWIIKRLLEDGYAVNTTIRSDPGRKRDVSFLTNLPGASEKLK
IFNADLSDPESFGPAVEGCVGIFHTATPIDFAVNEPEEVVTKRAIDGALGIMKAGLKAKT
VKRVVYTSSGSTVSFSSLEEKDVVDESVWSDVDMLRSVKPFGWSYAVSKVLTEKAVLEFG
EQNGLEVATVIAPFIVGRFVCPKLPDSIEKALLMVLGKKEEIGVIRYHMVHVDDVARAHI
FLLEHPNPKGRYNCSPFIVPIEEMGEILSAKYPEYQIPTVDELKGIKGVKQPHLTSKKLE
DAGFEFKYSLEDMFQDAIECCKEKGYL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcagagggaaaaggtagagtttgtgtcacgggaggcactgggttccttggttcatgg
atcatcaagagactccttgaagatggatatgctgttaataccactattagatctgaccca
ggacgcaagagagatgttagcttcctcacaaacctacctggtgcatcagaaaagctaaaa
attttcaatgctgatctcagcgacccagagagttttggtccagcagttgagggttgtgtt
ggaattttccacactgccaccccaattgattttgcagtgaacgagccagaggaagtggtg
accaaaagagccattgatggggcactaggaatcatgaaagcaggcctcaaagcaaagaca
gtgaagagggttgtttacacttctagtggctccaccgtttccttcagcagccttgaagaa
aaagatgtggtagatgagagtgtttggagtgatgttgatatgcttaggagtgtgaagccc
tttggatggtcctatgcagtttcaaaggtgttgactgagaaggctgtgcttgaatttgga
gaacagaatgggttggaagttgcaactgttattgctcctttcattgttggtcgttttgtt
tgtcccaagcttcctgactccattgagaaagctctgcttatggtgttgggcaaaaaggaa
gaaattggtgtcattcgttaccatatggtacatgtggatgatgtcgctagagcacatatc
ttcctgcttgagcatcctaatccaaaagggaggtataactgctcaccattcattgtaccc
attgaagagatgggtgaaattctttcagccaaatatccagaatatcaaataccaacagta
gacgagctgaagggaattaaaggtgtcaagcaaccacatttaacctccaagaaacttgag
gatgctggttttgagttcaagtatagcttggaggacatgtttcaggatgcaattgaatgc
tgcaaggaaaagggttatctttaa

DBGET integrated database retrieval system