KEGG   Glycine max (soybean): 100500015Help
Entry
100500015         CDS       T01710                                 

Definition
(RefSeq) uncharacterized LOC100500015
  KO
K08738  cytochrome c
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100500015
NCBI-ProteinID: NP_001235631
UniProt: C6SZC5
Position
18
AA seq 112 aa AA seqDB search
MASFEEAPPGNSKNGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgaagaagctcctcccggaaactccaagaacggcgagaagatcttcaag
actaagtgcgctcagtgccacaccgtggacaaaggtgccggtcacaaacaaggacccaat
ctgaatggtttgtttggaaggcaatctggcacaactcctggatattcctattctactgct
aacaaaaacatggctgtgatttgggaggaaaagaccttgtatgattacttgctcaacccc
aaaaagtatattccagggacaaagatggtgtttcccggtcttaagaaacctcaggaacgt
gcagatcttattgcatatcttaaagaatccactgcataa

DBGET integrated database retrieval system