KEGG   Glycine max (soybean): 100527034Help
Entry
100527034         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100527034
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00480  Glutathione metabolism
gmx00590  Arachidonic acid metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100527034
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100527034
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100527034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 100527034
NCBI-ProteinID: NP_001237632
UniProt: C6T333
Position
11
AA seq 167 aa AA seqDB search
MTTKDPKSVYDFVVKDAKGDDVDLSFYKGKVLLIVNVASQCGLTNSNYTELNQLYDKYKD
QGLEILAFPCNQFGKQEPESNDKIVDFVCSRFKSEFPIFDKIEVNGDNSAPLYKFLKLGK
WGIFGDDIQWNFSKFVVDKNGQVVGRYYPTTSPLSLERDIHQLLGIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaggatccaaaatccgtgtacgactttgttgtcaaggatgctaagggagat
gatgtagatctctccttttacaagggaaaagtccttctgattgtcaatgttgcttctcaa
tgcggcttgaccaactccaattatacggagctgaatcaattgtatgacaagtataaagac
caaggcctggagattctggcatttccatgtaatcaatttggtaagcaagaaccagaaagc
aatgataaaattgtggattttgtctgcagtcgcttcaaatctgaattccccatctttgat
aagattgaagtgaatggggacaattctgctcctttgtacaaattcttgaagttggggaaa
tggggaatttttggtgatgatattcagtggaacttttccaagtttgtggttgataagaat
ggacaagtagtgggtcgctattatcccaccacttctcctctcagccttgagcgagacatt
caccagcttctgggtatttcttga

DBGET integrated database retrieval system