KEGG   Glycine max (soybean): 100527141Help
Entry
100527141         CDS       T01710                                 

Definition
(RefSeq) NDPk domain-containing protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00230  Purine metabolism
gmx00240  Pyrimidine metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx04016  MAPK signaling pathway - plant
Module
gmx_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gmx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
gmx_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100527141
   00240 Pyrimidine metabolism
    100527141
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    100527141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gmx04131]
    100527141
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     100527141
Membrane trafficking [BR:gmx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100527141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 100527141
NCBI-ProteinID: NP_001235503
UniProt: C6T3F0
Position
8
AA seq 236 aa AA seqDB search
MASQVCKSASRAARSLLSSRFHSQGRALGAAAAVSLSSKVPLFYGKNGSGNGSASSSSSS
SWISGALALPAAAYMFQDQEVQAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGI
KVVIPKKEFAQRHYHDLKERPFFDGLCDFLSSGPVIAMVWEGQGVISYGRKLIGATDPQK
SEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNAEKWIYGAN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacaggtttgcaaatctgcttccagagccgcgaggtcccttctatcctctcgt
tttcactctcaaggacgtgcgcttggggctgctgcggctgtttcattgagcagcaaagtg
cctcttttttacggaaagaacggttctggaaatggatccgcttcttcatcatcatcatca
tcatggatttcaggagctcttgctcttcctgccgcagcttacatgttccaagatcaggag
gtgcaggcagctgagctggagcgcactttcattgccattaagcctgatggagtgcagaga
ggcctgatttctgagattatatctcgttttgagcggaaagggtacaagcttgtgggaatt
aaagtagtgattcctaaaaaggaatttgcccaaaggcactatcacgacctgaaagaaaga
cccttcttcgatgggctgtgtgattttctaagctctggccctgttattgcaatggtgtgg
gaaggacagggagttatttcctatggccgaaagctaattggagccacagatccacagaaa
tcagaacctggaaccattaggggtgatcttgctgttgttgttggaagaaacatcatccat
gggagtgatggtccagaaactgccaaggatgagattaagttgtggtttaagccagaggag
ttggttagtttcactagcaatgcagagaagtggatttatggtgccaactga

DBGET integrated database retrieval system