KEGG   Glycine max (soybean): 100775553Help
Entry
100775553         CDS       T01710                                 

Definition
(RefSeq) nicotianamine synthase
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100775553
Enzymes [BR:gmx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     100775553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_31 Methyltransf_25 CheR Methyltransf_23 Methyltransf_12 Methyltransf_11 Ten1 Methyltransf_24 Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 100775553
NCBI-ProteinID: XP_003532954
UniProt: I1KU88
Position
8
AA seq 286 aa AA seqDB search
MAAFQSINNIETQQIPPELLISQIMQLHASISKLESLRPCKQVNSHFTHLVKLCTLPSTI
DIEALPKEVQDMRDSLINLSGHAEGLLELEFSTFISLTPEPMKNVTLFPYYGNYVKLANM
ESKILKENGVLSPKKVAFVGSGPMPLTSIVMATHHMESTHFDNFDIDEKANEVARKIVAS
DSALEKRMKFETQDVMEVRERLGQYDCIFLAALVGMSREAKVKILGHIRKYMKEGGTLLV
RSAKGARAFLYPIVEERDMVNFEVLTIFHPTNDVINSVVLLRKPKA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttccaaagcatcaacaacattgaaactcaacaaattccaccagagctcctc
atatctcaaatcatgcaactccatgcaagcatctccaagcttgaatccctaaggccatgc
aagcaagtcaatagtcacttcacccacctagtgaagctttgcaccctcccttcaaccatt
gacatcgaagccttgcccaaagaggtgcaagacatgcgtgatagcctcattaacctaagt
ggccacgccgaggggctcctagagctcgaattctcgaccttcataagcctcacacctgag
ccaatgaaaaatgtaaccctattcccttattacgggaactatgtcaagctagccaacatg
gagagcaaaatcctcaaagaaaacggggttttgagccctaagaaagtggcctttgtaggg
tcagggccaatgccactcacctccatcgtcatggccactcaccacatggaatccacacac
tttgacaactttgacatcgacgaaaaggcgaacgaggtggcacgaaagatcgtggcttcg
gactcggccctcgagaagaggatgaagtttgagacacaggatgtgatggaagtgagggag
agattagggcaatatgattgcatctttctggctgcgcttgtgggaatgagtagggaagca
aaagtgaagattttgggacatataaggaagtatatgaaggagggagggactttgcttgtg
agaagtgcaaaaggggctagggctttcttgtaccctattgttgaggaacgtgacatggtg
aattttgaggttcttaccatctttcaccccacaaatgatgtgatcaactcagttgttctt
cttcgcaagcctaaagcttaa

DBGET integrated database retrieval system