KEGG   Glycine max (soybean): 100776238Help
Entry
100776238         CDS       T01710                                 

Definition
(RefSeq) aldose 1-epimerase-like
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00052  Galactose metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100776238
   00052 Galactose metabolism
    100776238
Enzymes [BR:gmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100776238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100776238
NCBI-ProteinID: NP_001242054
UniProt: C6TA31
Position
7
AA seq 339 aa AA seqDB search
MADQSPKPETFELNNGSMQVLLSNLGCTIISLSVPGKDGLLSDIVLGLESVESYQKGLAP
YFGCIVGRVANRIKDGKFTLDGIQYSLPINKPPNSLHGGNVGFDKKVWEVVEYKKGNTPS
ITFRCHSHDGEEGYPGDVTVTATYTLTSSTTLRLGMEGVPKDKPTIVNLAQHTYWNLAGH
NSGNILDHSIQLWANHITPVDENTVPTGKIMPVKGTPFDFTSENRIGNTISQVGLGYDHN
YVLDCGEEKEGLRHAAKVRDPSSSRVLNLWTNAPGVQFYTANYVNGVQGKGGAIYGKHAG
LCLETQGFPNAINQPNFPSVVVRPGEKYQHTMLFEFSLE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcagagccccaaaccagagaccttcgaactcaacaatggcagcatgcaagtc
ctcctcagcaatctcggctgcaccatcatctccttatccgtacccggaaaagatggattg
ttatccgacatcgttcttggcctagaatctgttgaatcctatcagaaaggtctcgctcct
tattttggttgcattgtgggcagggttgcaaaccgaattaaggatggcaagtttacactt
gacgggattcaatactctttgccaatcaacaaacccccaaacagtctccatggtggaaat
gttgggtttgataagaaggtatgggaggtagttgaatataaaaaaggaaataccccctca
atcacttttaggtgccacagtcatgatggagaggaaggttatcctggggatgtcaccgtt
actgcaacttacacgctcacctcaagcacaactctgaggcttggcatggaaggtgtgccg
aaggacaagcccaccatagttaacttagctcagcatacctactggaacttagctggtcac
aactcagggaatatacttgaccattcaattcagctatgggctaatcatatcactcctgtc
gacgagaatacagtgccaaccggtaaaatcatgccagtgaagggtaccccttttgatttt
acgtcagagaatagaataggcaacaccattagtcaggttggactgggatatgaccacaat
tatgtgcttgattgtggggaagagaaagagggtttgagacacgctgcaaaggtgagggat
ccatcaagttcaagagtacttaacttgtggacaaatgctcctggtgtccaattttacact
gcaaactatgttaatggtgttcaaggaaaaggaggtgctatatatggaaagcatgccggg
ttatgtctggagacacaaggattccctaatgccataaaccagccaaattttccatctgtt
gtggttcgtccgggtgagaagtatcaacataccatgttgtttgagttttcccttgagtga

DBGET integrated database retrieval system