KEGG   Glycine max (soybean): 100777507Help
Entry
100777507         CDS       T01710                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP) isoform X2
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00020  Citrate cycle (TCA cycle)
gmx00620  Pyruvate metabolism
gmx00710  Carbon fixation in photosynthetic organisms
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Module
gmx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
gmx_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100777507
   00020 Citrate cycle (TCA cycle)
    100777507
   00620 Pyruvate metabolism
    100777507
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100777507
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     100777507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 100777507
NCBI-ProteinID: XP_003516278
UniProt: I1J6V7
Position
1
AA seq 648 aa AA seqDB search
MPTSDNAGNGNGLAKIQQLGDNEEGRPTVKAQTIDELHSLQKKKSAPSTPKGSLPTSASV
FTEEERNKQQLESISASLASLTRESGPKVVKGDPAARKYEASRVEHVPHQILTPTIAVSD
SALKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRCPRDKRVVKDEVTE
NELWWGKGSPNIEMDEHSFMVNRERAVDYLNSLDKVFVNDQFLNWDPENKIKVRIVSARA
YHSLFMHNMCIRPTTEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLSLARKEMVI
LGTQYAGEMKKGLFSVMHYLMPKRKILSLHSGCNMGKGGDVALFFGLSGTGKTTLSTDHN
RYLIGDDEHCWSESGVSNIEGGCYAKCIDLSRENEPDIWNAIKFGTVLENVVFDEHFREV
DYTDKSVTENTRAAYPIDYIPNVKLPCVGPHPKNVILLACDAFGVLPPVSKLSLSQTMYH
FISGYTALVAGTEEGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQNHGATGWLVNTG
WSGGSYGCGSRIKLSYTRKIIDAIHSGSLLDVEYKKTEIFGLEIPTEVEGVPSEILEPEN
TWSDKQAYKETLLKLAGLFKNNFETFTYGENNQVTKEILAAGPIIHDA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaagtgacaacgctggaaacggaaatgggctggcaaagattcaacaacttggt
gacaatgaagaaggtcgtccaacggtgaaggctcaaaccattgatgagcttcactctttg
cagaagaagaaatctgcaccttccactcccaagggctctctgcctacgtctgccagcgtt
tttaccgaggaagaacgcaacaaacagcagcttgagtccatcagtgcatctttggcgtca
ctaacaagagaaagtggaccaaaggtagtgaaaggggatccagcagctaggaaatacgaa
gcctcaagggttgaacacgtgccgcaccaaattctcacacctaccattgctgtcagtgac
agtgccttgaagtttacacatgttctctataacctctccccagcagaactttatgaacaa
gcgatcaagtatgagaaaggatcgttcattacttccactggggcattggctacgctttct
ggggccaagacgggtcggtgtcccagagacaagcgcgtggtgaaagatgaagttactgag
aatgaactttggtggggaaagggttctcctaacatcgagatggacgagcacagtttcatg
gtgaatagagaaagagccgttgattatttgaactctttggacaaggtctttgtgaatgac
caattcttgaactgggacccagagaacaaaatcaaagttaggattgtctctgccagagct
taccattccttgtttatgcacaacatgtgcattcgaccaactaccgaagagcttgagaat
tttggcacaccagacttcactatttataatgctggacagtttccttgcaatcgttacact
cactacatgacatcttctactagcattgatcttagtcttgcaaggaaggaaatggtgatc
cttgggacacagtatgcaggggaaatgaagaaaggtctctttagtgtcatgcactatctc
atgcccaagaggaaaatcctctccctacactctggctgcaacatgggcaaaggtggagat
gttgctctcttttttggactctcaggtactggaaagaccactctgtccacggatcataat
aggtatttaattggagatgatgaacactgttggagtgagagtggtgtctcaaacattgaa
ggtggttgctatgccaaatgcattgatctctcaagggagaatgaacctgacatctggaac
gccatcaaatttgggacagtcttggagaatgttgtttttgatgagcattttcgagaagtt
gattacacagacaaatcagttacagaaaatactcgtgcagcttatccaattgactacatt
ccaaatgtgaagttaccatgtgttggtcctcaccctaagaatgtgatccttttggcatgt
gatgcatttggtgtgcttccacctgtgagtaagctaagcctgtcgcagaccatgtaccat
ttcatcagtggatacacagctttggtggctggcacagaagagggcataaaggagccacag
gcaacattttcagcttgttttggtgcagcctttataatgctacaccctacaaagtatgca
gccatgcttgctgaaaagatgcagaatcatggtgctactggatggcttgttaacacagga
tggtctggtggaagctatggttgtggaagtcgtattaaactatcttatacaagaaaaatt
attgatgctattcactctggaagcctcttggatgttgagtacaagaagactgagattttt
ggacttgagatccccactgaagtggagggagtcccctcggaaattctagaacctgagaac
acgtggtcagacaaacaagcctacaaggagacactattgaagctggctggattgttcaag
aacaattttgaaacattcacctatggagagaacaaccaagtgacaaaggagattcttgct
gctggaccaatcattcatgatgcttaa

DBGET integrated database retrieval system