KEGG   Glycine max (soybean): 100781674Help
Entry
100781674         CDS       T01710                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00970  Aminoacyl-tRNA biosynthesis
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100781674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gmx03029]
    100781674
Enzymes [BR:gmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100781674
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100781674
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100781674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 100781674
NCBI-ProteinID: XP_003536373
UniProt: K7LKQ2
Position
10
AA seq 143 aa AA seqDB search
MSSKGLLRGASLTANAVWHRSSFFPKVTVSVHRKLVKFRSFSLTTTCSSLLPPDLPRLAK
TAQISLTPNEVEEIAPKIQQVIEWFGQLQGVDLESVEPSIRAETENNLRDNDPETFDHRD
ALIASVPSYEEPYIKVPRVLSMD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaaagggttgctgagaggagcttcgttaactgcaaacgcagtgtggcataga
agcagtttcttcccaaaggtaacggttagcgtccaccgcaagttggtgaaatttcgaagc
ttctcattaaccaccacttgctcctctcttctacctccggatttgccgcgtttggcaaaa
acggctcaaatttcacttaccccaaacgaggttgaagaaattgctcccaaaattcaacaa
gttatagaatggtttggacagcttcagggtgttgatcttgaaagtgttgaaccctcgatc
agagcagagacggaaaacaatttgcgtgataatgatcctgaaacatttgaccatagggac
gccttgatcgcttctgtcccgagctatgaggagccttatattaaagttccgagggtctta
agcatggactaa

DBGET integrated database retrieval system