KEGG   Glycine max (soybean): 100782772Help
Entry
100782772         CDS       T01710                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gmx01003]
    100782772
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     100782772
Glycosyltransferases [BR:gmx01003]
 Polysaccharide
  Structural polysaccharide
   100782772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 100782772
NCBI-ProteinID: XP_003554414
UniProt: I1NAI2
Position
19
AA seq 533 aa AA seqDB search
MDRFSSSTILPEAFQGAKDDFTMQLALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERV
YMGIVITLVKLFGRKPEKRYKWEPMKDDIELGNSCYPMVLVQVPMYNEREVYQLSIGAAC
GLSWPSDRIIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGM
KRSYVKQCDCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECLMTRMQE
MSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKG
WKFLYLSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIINNKKVSLWKKIHVIY
SFFFVRKVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTPRSLHLM
VFWILFENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKTKAGGKAPKKPRFRIGDR
IHLLELGVAFYLFFCGCYDIMFGKNHFFIFLFIQSLAFLIMAFGYVGTIVPNS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcttttcttccagtaccattctccccgaagcgtttcaaggtgccaaagatgac
ttcaccatgcagcttgcattggtgtggaaccaaatcaaagcgccactgattgtcccgttg
ctgagactagcagtgtttctgtgcttgatcatgtcggtgatgatgttcattgagagagtc
tacatgggcattgtcatcactctggtgaagttgtttgggagaaagccagagaaacgttac
aagtgggagccaatgaaggacgacattgagttgggaaactcttgttacccaatggttctt
gttcaagtccccatgtacaacgaaagagaggtttatcagttgtctattggagcagcatgt
gggctttcttggccttcagataggatcatcatacaagtccttgatgactccactgaccca
acaatcaaggagttggtgcagcttgaatgccaaagatgggcaagcaaaggggtgaacata
aagtatgaggttagggacaataggaatgggtacaaagcaggggctctcaaagaaggcatg
aagcgtagctacgtgaaacaatgtgattgtgttgctatctttgacgctgattttcaacca
gagcctgatttcctgtggcggaccgttccatttctcgtgcacaatcccgaattagccctc
attcaagcacggtggaaatttgtgaatgccgatgaatgtttgatgacccgaatgcaagag
atgtcactagattaccattttactgtggaacaagaagtggggtcttccacttacgccttc
tttggtttcaacgggacagcgggagtatggagaatttcggcgcttaatgaggctggtgga
tggaaggataggaccacagtggaagatatggacttggccgtgcgagccagtctcaaagga
tggaaattcttatacttgtctgacttgaaggttaaaaatgagttgccaagtactttcaag
gcctaccgctaccaacagcaccgttggtcttgtggtccagccaatctttttaggaaaatg
gtcatggagatcataaataacaagaaagtgtcattgtggaagaagatacatgtgatttac
agcttcttctttgttcggaaggtcgtagcacacataaacacgtttgtgttttattgcatt
gtattacctgcaacagttttggtgcctgaggttgtggtcccaaagtggggagctgtctat
atcccttccatcatcactattcttaatgcagttggaactccaaggtcactccatttgatg
gtcttctggattctctttgagaatgtcatgtctctgcatcgaacaaaggcaacgattatt
ggtttacttgaggcaagtcgagtgaacgaatgggttgtcactgaaaaacttggtgatgct
ctcaagactaaagcaggaggtaaagcacctaaaaagcctcgattcaggattggagacagg
attcacttgttggaacttggtgtcgcattctacctcttcttttgtggctgctatgatatt
atgtttgggaaaaaccacttcttcatcttcctctttatccaatctttggccttcctcatc
atggcatttggatatgttggcaccattgttcccaactcctaa

DBGET integrated database retrieval system