KEGG   Glycine max (soybean): 100787184Help
Entry
100787184         CDS       T01710                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gmx01002]
    100787184
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gmx03110]
    100787184
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     100787184
Peptidases and inhibitors [BR:gmx01002]
 Serine peptidases
  Family S8: subtilisin family
   100787184
Chaperones and folding catalysts [BR:gmx03110]
 Intramolecular chaperones
  Subtilisin family
   100787184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Skp1 Prp19
Motif
Other DBs
NCBI-GeneID: 100787184
NCBI-ProteinID: XP_006589538
UniProt: I1LDQ6
Position
10
AA seq 1372 aa AA seqDB search
MHNQHTLLLRFPSLPSHSLTILHRTTKTKLNSTRRKHTPTSSFRRSNWIVPKAMHCTSLC
GGGNDNNNNNDASFRNLNESTFLASLMPKTEIGADRFLHSHPDYDGRGALIAIFDSGVDP
AAAGLQVTSDGKPKIIDILDCTGSGDIDTSKVVKADADGCISGASGASLVINTSWKNPSG
DWHVGYKLVYELFTENLTSRLKKERKKKWDEKNQEEIAKAVKQLTDFDQEHIKVEDAKLK
KVREDLQNRLDLLRKKSESYDDKGPAIDAVVWYDGEVWRVALDTHSLEDDPDCGKLANFI
PLTNYRTEKKYGIFSKLDACTYAVNVYNDGNVLSMVTDSSPHGTHVAGIAAAFHPEEPLL
NGVAPGAQLISCKIGDSRLGSMETGTGLTRALIAAVEHKCDLINMSYGEPTSLPDYGRFV
DLANEAVNKHRLIFVSSAGNSGPALSTVGAPGGTSTNIIGVGAYVSPAMAAGAHCVVEPP
SEGLEYTWSSRGPTTDGDLGVSVSAPGCAVAPVPTWTLQRRMLMNGTSMASPSACGGIAL
LISAMKAEGIPVSPYSVRKALENTSIPIGDSPEDKLSTGQGLMQIDKCYEYIQQSQNIPS
VQYQINIKQSGKTNPSSRGIYLREANACRQPTEWMVQVDPKFHEDANKLEELAVFEECIE
LHSSDKTVVKAPEYLLLTHNGRTFNVFVDPTNLNDGLHYYEVYGIDCKAPWRGPLFRIPI
TITKPMAVTDRPPQVSFSKMLFQPGHVQRKYIEVPHGASWVEATMNASSFDTARRFFVHT
VQICPLQRPITRRNVINFSSPTAKSFTFRVVGGQTLELVIAQFWSSGIGSPETTSIDLEV
VFHGIKVNKEEIVLDGSEAPIRIDAEALLASEKLAPVAILNKIRVPYRPIDAKISSLSSD
RDKLPSGKQILALTLTYKIKLEDGAEIKPQIPFLNDRIYDTKFESQFYIISDSNKKVYSS
GDAYPNSTKLPKGEYNLQLYLRHDNVQVLEKMKQLVLFIERSLEEKEIIWLSFFSQPDGP
LMGNDSFKSSTLVPGIKEGFYLGPPAKDKLPKNSLQGSVLVGSISYGKLLLAGQRDRKYP
EKHPVRYRVSYIIPPNKVDEDKGKKSSSSSKKTVSERLEEEVRDAKIKVLGGLKQESDEE
CLEWKELSASLKTEYPKYIPLLAKILEGLVSRSSIKDKVHHDEEVIDAANEVIDSIDREE
LAKFFALKNDPEDEEAEKIKKKMESARDQLAEALYQKGLALAEIESLKEVDKSLASAATE
VAKQDVEKTDEQSNDDAVHPDLFLENFNELKKWVDVKCTKYGILLVTNERRNQRLGTALK
VLSDIIQDDAEPSKKKFYELKLSLLEEIGWTHFAANEREWMLVRFPPSLPPF
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgcataaccaacacacactcttactcagattcccctcattgccctctcactctctaacc
atccttcaccgcacaacaaagacaaagctcaacagcacgagaaggaaacacactcccact
tcctccttcagaagaagcaattggattgtccccaaagcaatgcactgcacttctctctgt
ggtggtggcaacgacaacaacaacaacaacgatgcctctttccgcaacttgaatgagtcc
actttcctggcttctctcatgcccaagacagagattggcgccgatcgtttcctccattct
caccctgactacgacggtcgcggtgctctcatcgctatcttcgattctggggtagacccg
gctgctgctggattacaggttacctcagatgggaaaccaaaaattattgatattcttgat
tgcaccgggagtggagatattgatacctcaaaggtggtgaaggctgatgctgatggttgt
atttctggggcttcaggggcatctttggttatcaacacttcatggaaaaacccatctggt
gactggcatgtgggttataaattggtgtatgagctctttacagaaaacttgacttctcgt
ttgaagaaagaaagaaagaaaaaatgggatgagaaaaaccaggaggaaattgccaaggcc
gtaaaacagcttactgattttgatcaggaacacatcaaggtggaggacgctaaacttaaa
aaggttcgtgaagacctccagaataggcttgatcttctgaggaagaaatctgagagttat
gatgataaagggcctgccatagatgctgttgtctggtatgatggagaggtttggagggtt
gctcttgacacacacagtcttgaggatgatccagattgtgggaagcttgctaactttata
cccttaaccaattataggactgagaagaaatatggtatcttcagcaaattagatgcttgt
acatatgctgtgaatgtctataatgatggaaatgtcttaagcatggtaacagatagctcc
cctcatggaacccatgttgctggtatagctgctgcattccacccagaggaacctttgttg
aatggagttgctcctggagcacaattaatatcttgtaaaattggggactctcgcttaggt
tcaatggaaactggaactggtttgactcgggcactgatagctgctgtggagcataaatgt
gatcttatcaatatgagttatggtgagcctacatcactgccagactatggacggttcgtt
gaccttgcgaatgaagcagtaaacaagcatcgtctgatatttgtgagtagtgccggtaat
agtgggccagcattgagcactgttggtgcacctggtggtacatctacaaatattataggt
gttggagcttatgtttctcctgctatggcagctggtgctcattgtgttgttgagcctcct
tctgaggggcttgaatacacttggtctagccgtggaccaacaactgatggagatcttggt
gtctctgtaagtgctccaggttgtgctgttgctcctgttcctacatggactcttcaacgg
cgcatgctcatgaatgggacatcaatggcatctccatcagcctgtggtggaattgcattg
ctcataagtgcaatgaaggctgagggaatccctgtgagtccatatagtgtgaggaaggcc
cttgagaatacatctattcccataggtgattcacctgaggataaattgtccactgggcaa
gggcttatgcaaattgacaagtgctatgaatatattcagcagtctcaaaatattccgagt
gttcagtatcaaataaacataaagcaatctggaaaaacaaatccttcttcacggggcatc
tacttaagggaggctaatgcttgccgacaacccactgagtggatggtgcaagttgatcca
aaatttcatgaagatgccaacaagcttgaagaattggctgtgtttgaggagtgcattgag
ttacactcttcagataagacagttgttaaagcccccgagtatctactgctcactcataat
ggccgcaccttcaatgtatttgtggatcctaccaatttaaatgatggtctgcattattat
gaggtctatggtattgactgcaaagcaccatggcgtggtcctcttttcagaattccaatt
actataaccaagcccatggctgtaactgacagacctcctcaagtttcattttcaaagatg
ttattccagccaggccatgtacagaggaaatatatagaagtaccacatggtgcatcttgg
gttgaagcaaccatgaatgcatcaagttttgatacagctcgaagattttttgtgcacaca
gttcagatatgtccattgcaaagacccattacacgaaggaatgtgattaatttttcttcc
cctactgccaaaagcttcacctttagggtagtaggtggtcagacattggaactagtcata
gctcagttttggtccagtggcattgggagtcctgagaccaccagcatagatcttgaggtt
gtgtttcatggtataaaagttaataaagaggaaattgtacttgatgggagtgaagcacca
atcagaattgatgctgaagcgctactggcatctgagaaacttgcacctgtagctatttta
aataagataagggtcccatatcgaccaatagatgctaagattagttcactttcaagtgat
cgtgacaaactcccctctggaaaacagatactagcattgacgttaacatacaagatcaaa
ttggaagatggagctgaaataaaacctcaaataccatttctaaatgatcggatatatgat
acaaaatttgagtctcaattttatatcatttctgattcaaataagaaagtatattcaagt
ggagatgcctatccgaattctacaaaactacccaagggagaatacaatttacagctatat
ttgaggcatgacaatgtgcaggttttggaaaagatgaagcagctggtgttattcattgag
cgaagtttagaagagaaggagatcatttggttatcctttttctctcaaccagatggtcca
ctgatgggaaatgattcctttaagtcctcaacgttagttccaggtatcaaagaaggattt
tatcttggtcctccagcaaaagacaaacttcctaagaactctctacaaggatctgtattg
gtgggatcaatatcatatgggaaactattattagctggtcaaagggatcgtaaatatcct
gaaaagcatcctgtgcggtatcgggtttcttacatcattcccccaaataaggttgacgag
gacaagggaaaaaaatcttcctcatcttccaagaagacagtttctgaacgcttagaagaa
gaggtacgagatgcaaaaataaaagtgcttgggggtctaaaacaagaaagtgatgaagag
tgcttggaatggaaggagttgtctgcctcgctcaaaactgaatatccaaagtacattcca
ttgcttgccaagattttggaaggtttagtttctaggagtagtatcaaagacaaagtccat
catgatgaagaggtaattgatgcagcaaatgaggttattgacagtattgatagagaagag
ttggcaaaattttttgcactaaaaaatgatccagaagatgaggaagccgagaaaatcaag
aaaaagatggaatcagcccgtgatcagttggcagaggcactttaccaaaaggggcttgca
ctggcagaaattgagtctttaaaggaggtagataagtcattggcttcagctgcaacagaa
gttgcaaaacaagatgtggagaaaactgatgagcaatccaacgatgatgctgttcatcca
gacttgtttttagagaacttcaatgaactgaagaaatgggttgatgtcaagtgcacaaaa
tatggaatcctcttggtgacaaacgagaggcgtaatcaaaggcttgggaccgcactgaag
gtactcagtgacattattcaagatgatgccgagccttccaagaagaaattctatgaacta
aagctctctttgcttgaggaaattggatggacgcattttgctgcaaatgagagagaatgg
atgcttgtgcgtttccccccaagcttgcccccattctag

DBGET integrated database retrieval system