KEGG   Glycine max (soybean): 100787491Help
Entry
100787491         CDS       T01710                                 

Definition
(RefSeq) apyrase 2
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00230  Purine metabolism
gmx00240  Pyrimidine metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100787491
   00240 Pyrimidine metabolism
    100787491
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     100787491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Ppx-GppA
Motif
Other DBs
NCBI-GeneID: 100787491
NCBI-ProteinID: XP_003548776
UniProt: A0A368UGT8
Position
16
AA seq 463 aa AA seqDB search
MSKDYLIILSLLLSTVLATASSSSSSSSLYLGKGFSHRKLSPSYHIHKTIDESYAVIFDA
GSTGSRVHVYRFNQQLDLLRIGQDLELFVKTMPGLSAYAENPQDAAESLIPLLEEAEAAV
PQEFHPRTPVKLGATAGLRQLEGDASDRILQAVSDMLKNRSTLNVGADAVSVLSGNQEGA
YQWVTINYLLGNLGKHYSETVAVVDLGGGSVQMAYAVSETDAAKAPRAPDGVESYITEMF
LRGKKYYLYVHSYLRYGMLAARAEALKVRDSENPCILAGFDGYYVYGGVQYKAKAPPSGS
SFSQCQNVVVEALHVNATCSYKDCTFGGIWNGGGGAGENNFFIASFFFEVADEAGFVDPN
APNAKVRPVDFENAAKVACNTELKDLKSIFPRVKDGDVPYICLDLVYEYTLLVDGFGIDP
QQEITLVRQVEYQDSLVEAAWPLGSAIEAISSLPKFEKLMYFI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggattatctaatcatactttctctccttctttccacggtgcttgcaactgca
agttcttcttcttcttcttcctccctctatcttgggaagggcttctcccatcgcaaattg
tctcccagttatcacattcacaaaaccattgacgaatcctatgcagttatcttcgatgct
ggtagcacgggaagccgtgtacatgtctatcgttttaaccaacaattagatctccttcgc
attggccaagaccttgagttgtttgtcaagactatgccaggtttaagtgcttacgctgag
aatccacaagatgctgcagaatctcttattccacttttggaggaagcagaagctgctgtt
cctcaggagtttcaccccaggacgccagttaaacttggagcaactgcaggtttaaggcaa
ttggaaggggatgcttctgataggatattgcaggcggtcagtgacatgctcaagaacaga
agcacactgaacgttggggccgatgcagtttcagtgttgagtggaaaccaagaaggagct
tatcaatgggtaacaattaactatctactgggaaacttgggaaagcattattcagaaact
gttgcagtagttgatcttggaggtggatctgttcaaatggcttatgcagtctcagagaca
gatgctgcgaaggctccacgagcaccggacggagtggaatcatacataacggagatgttc
cttaggggaaagaaatattacctctatgtacacagttacttgcgatacggtatgctagca
gctcgtgcagaggctttaaaggttcgtgattctgaaaatccttgtattttggctggcttt
gatgggtattacgtatatggaggagtgcagtataaggccaaagctcccccttctggctca
agcttcagccaatgccaaaatgttgttgttgaagcactccatgttaatgcaacatgctct
tacaaggattgcactttcggagggatatggaatggtggtgggggagctggagaaaacaac
ttttttattgcctcatttttctttgaagttgccgatgaggctggttttgttgatccaaac
gcccccaatgccaaagttcgtcctgtggattttgagaatgcagcaaaggttgcctgtaac
acagaattaaaggatctcaaatccattttccctcgtgttaaggatggagacgttccttat
atatgcttagatcttgtatacgaatatacattgctcgttgatggatttggcatagatccg
cagcaagagattacgttggtgaggcaagttgagtatcaagattctctcgtggaagcagca
tggccactaggcagtgccatagaagccatatcatcattacctaaatttgagaaattaatg
tatttcatttaa

DBGET integrated database retrieval system