KEGG   Glycine max (soybean): 100788531Help
Entry
100788531         CDS       T01710                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gmx  Glycine max (soybean)
Pathway
gmx03040  Spliceosome
gmx04141  Protein processing in endoplasmic reticulum
gmx04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100788531
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100788531
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100788531
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gmx01009]
    100788531
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gmx03041]
    100788531
   03009 Ribosome biogenesis [BR:gmx03009]
    100788531
   03110 Chaperones and folding catalysts [BR:gmx03110]
    100788531
   04131 Membrane trafficking [BR:gmx04131]
    100788531
   03051 Proteasome [BR:gmx03051]
    100788531
   03029 Mitochondrial biogenesis [BR:gmx03029]
    100788531
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmx04147]
    100788531
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100788531
Spliceosome [BR:gmx03041]
 Complex B
  Other components
   Prp19 complex
    100788531
 Complex C
   Prp19-CDC5 complex
    100788531
Ribosome biogenesis [BR:gmx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100788531
Chaperones and folding catalysts [BR:gmx03110]
 Heat shock proteins
  HSP70 / DNAK
   100788531
Membrane trafficking [BR:gmx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100788531
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100788531
Proteasome [BR:gmx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100788531
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100788531
Exosome [BR:gmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   100788531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 100788531
NCBI-ProteinID: XP_014623688
Position
15
AA seq 601 aa AA seqDB search
MAPRKVKAMGIDLGTTYSCVAVWNHNRVEVIPNDQGNRTTPSYVAFTDTQRLLGDAAINQ
RSMNPQNTVFDAKRLVGRRFSDQSVQQDIKLWPFKVVPGARDKPMIAVTYKDEEKLLAAE
EISSMVLFKMKEVAEAHLGHFVKDAVITVPAYFSNAQRQATKDAGKIAGLNVLRIINEPT
AAAIAYGLDKKGWREGEQNVLVFDLGGGTFDVSLVTIDEGMFKVKATVGDTHLGGVDFDN
KLVNYLVGIFKRRYKKDIGENPKALGRLRSACEKAKRILSSSSQTTIELDSLCGGADLHA
IVTRALFEELNKDLFMKCMETVEKCLKEARIAKSQVHELVLVGGSTRIPKVQQLLKDMFS
VNGNKELCKSINPDEAVAYGAAVQAAILSGEGDKKVEELLLLDVMPLSLGIETDAGEMSV
LIPKNTMIPTKRESVFSTFSDNQTSVLIKVFEGEHAKTEDNFLLGKFELSGFTPSPRGVP
QINVGFDVGVDGIVEVTARDRSTGLKKKITISNKHGRLSPEEMRRMVRDAEKYKAEDEEV
SNKVRAKNLLENYAFEMRDRVKNLEKVVEETIEWLDRNQLAETDEFEYKKQELEEKFRKF
R
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcacccagaaaagtcaaagccatgggcattgacttgggcaccacctacagctgcgtg
gctgtgtggaaccataaccgcgtcgaggtcattcccaacgaccaaggcaaccgcaccacc
ccttcctacgttgccttcaccgacactcaaaggttgttgggcgacgctgccatcaaccag
cgatccatgaatcctcaaaacaccgtcttcgacgccaaacgtttggtcggtcgcagattc
tccgaccagtccgtacagcaagacataaagttgtggccttttaaggttgtccctggagcc
agagacaagcccatgattgctgtaacatacaaagacgaagagaaactccttgcagccgaa
gagatatcttccatggtgctgtttaagatgaaggaggttgccgaagcccatttgggtcat
ttcgtaaaggatgcagtgatcactgtccctgcttacttcagcaacgcgcagagacaggcc
actaaggatgccgggaaaatcgcgggtttgaacgtgttgaggatcatcaacgagccaacc
gcggctgctattgcttacgggttggacaagaaagggtggagagaaggtgagcagaacgtg
cttgtgtttgacctcggtggtggtacttttgatgtttccctggttacaattgatgaaggg
atgtttaaggttaaagccacggtgggagatacccatttgggaggtgttgactttgacaac
aaattggtcaactatctcgtgggtattttcaagaggaggtacaagaaggacattggtgaa
aaccccaaagctcttggaaggttgaggtcagcgtgtgagaaagctaagaggattctctct
tcaagttcccaaaccactattgagcttgattctttatgtggaggggctgatctacatgca
attgttacaagggccttgttcgaggaactgaacaaggacttgtttatgaagtgtatggag
acggtggagaagtgcctcaaggaggcaaggattgctaaaagccaagttcatgagcttgtt
ctggtaggagggtctactagaattccaaaggtgcagcaacttttgaaggacatgttcagt
gttaatggtaacaaggaactttgtaaaagcataaaccctgatgaggccgtggcgtatggt
gcggcggttcaggccgccattttgagtggcgaaggagacaagaaggtggaggagttgttg
ctgctggatgtgatgccgcttagtcttgggattgagactgatgctggtgaaatgtcagtg
ttgattcccaagaacaccatgatccccaccaagagggagagcgtcttctccactttttct
gataatcaaacaagtgttttgatcaaagtgttcgagggggagcatgcaaagacagaggat
aacttccttcttgggaagtttgagctttctggtttcactccatcgccaaggggagttcca
caaatcaatgtggggtttgatgttggtgttgatggcattgtggaagtcactgctagagat
aggagcacggggctgaagaagaagatcacgatcagcaacaagcatgggaggttgagtcct
gaagagatgaggaggatggtgagagatgcagagaagtataaggcagaggatgaggaggtg
agtaacaaggtgagggccaagaacttgcttgagaattatgcctttgaaatgagggacaga
gtgaagaaccttgagaaggttgtggaggagaccatagagtggcttgacagaaaccaattg
gctgaaactgatgagtttgagtacaagaagcaggagttggaagaaaagtttcggaagttt
aggtaa

DBGET integrated database retrieval system