KEGG   Glycine max (soybean): 100789421Help
Entry
100789421         CDS       T01710                                 

Definition
(RefSeq) non-specific phospholipase C4
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00562  Inositol phosphate metabolism
gmx00564  Glycerophospholipid metabolism
gmx00565  Ether lipid metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100789421
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100789421
   00565 Ether lipid metabolism
    100789421
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:gmx02042]
    100789421
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     100789421
Bacterial toxins [BR:gmx02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   100789421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 100789421
NCBI-ProteinID: XP_003547754
UniProt: I1MM41
Position
16
AA seq 517 aa AA seqDB search
MSSSSGTSATPYPIKTIVVLVQENRSFDHMLGWMKSLNREIDGVTGLESNQVSTFDPNSN
RVYFGDQSGFEEPDPGHTVEDVYEQVFGEPWSESSAANKLSPRMKGFAQNSAKQKKGSTA
ETVMNGYKPDLLPVYKELVKEFAVCDRWFASVPGPTQPNRLYVHSATSHGLTTQDTKKLI
GGLPQKTIFDSLDENGFSFGIYYQYPPSTLFFRNLRKLKYIDNFHQFDLKFKKQCKEGKL
PNYVVIEQRYFDLLSLPANDDHPSHDVAEGQKFVKEVYEALRASPQWNEMLFVIIYDEHG
GFYDHVPTPVDGVPSPDDIAGPEPFKFQFDRLGVRVPTIIISPWIEAGKVLHEPSGPFPT
SQYEHSSIPATVKKIFNLPQFLTKRDAWAGTLEDLLSLSTPRTDCPVKLPDPVKLREAAS
AEQQTQLSEFQEDLIYMAATLNGDHNKSIYHKLTENLTVSEAVKYCEDAFGTFLNECEKA
KQSNRIDGSEIVYCARPHTAPQSKNFWHKMLSCILCN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaagttccggtactagtgccacgccttaccccatcaaaacgattgtcgttttg
gttcaagaaaaccgttcctttgaccacatgttgggttggatgaagtccctcaaccgggaa
attgacggggtcaccggtttggagtcaaaccaggtttccacattcgatccaaactcgaac
cgggtttacttcggcgaccagtccgggtttgaagaaccggatccaggtcacacggttgag
gatgtctacgagcaagtttttggcgagccgtggagtgaatcctcggcggcaaataaactg
tccccgaggatgaaaggttttgcccaaaattcggcaaagcaaaagaagggatcaacggcg
gaaacggtgatgaatggctataaaccggatttattaccggtttacaaagagttggttaag
gaatttgctgtttgtgataggtggtttgcttcggttcccggtccgacccaaccgaaccgg
ctttacgtgcactctgcgacgtcgcatggattgaccacacaggacacgaagaaacttatt
ggaggcttgccacagaagactatattcgattctttggacgaaaatgggttcagctttgga
atatattatcagtacccgccatccactcttttttttagaaatcttaggaaattgaaatac
atagacaactttcatcaattcgatttaaagttcaagaaacagtgcaaagaagggaaactg
ccaaactacgtggtgattgagcaaagatactttgacttgttatcactgccagcgaacgat
gaccatccatcccatgatgttgctgaggggcaaaaatttgtgaaagaagtgtatgaggca
ctaagagctagtccccagtggaatgaaatgttgtttgtgattatatacgatgagcatggc
gggttttatgatcacgtgccaacccctgtggatggagtgcctagcccagatgacattgct
ggtcctgaaccattcaagtttcagtttgatagacttggtgttagggttcctaccatcatt
atttctccatggatcgaggcaggaaaagtgttgcacgaaccttcggggccattcccaaca
tcacagtatgagcattcatcaataccagcaactgttaagaaaatattcaatctacctcag
tttttgacaaagcgagacgcatgggctggaacactcgaagatctcttatctctaagcacc
ccacgtactgattgtccagtgaaattgcctgaccccgtcaaactgcgagaggctgcttcc
gcggaacaacaaacgcaattgagtgaatttcaagaagatttgatatatatggcagcaact
ctaaatggggatcataataagagtatataccacaagctaactgagaacttaactgtttcg
gaggcagtgaaatactgtgaagatgcatttggaacattcttgaatgagtgtgagaaagca
aaacaaagtaatagaattgatggatctgaaattgtttattgtgctagaccgcatacggca
ccacaatccaaaaatttctggcacaagatgctgtcatgtatattatgtaattga

DBGET integrated database retrieval system