KEGG   Glycine max (soybean): 100790773Help
Entry
100790773         CDS       T01710                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100790773
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     100790773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_5 ThiI EF-hand_6 EF-hand_8 NAD_binding_8 NAD_binding_7 EF-hand_7 DUF1002 p25-alpha
Motif
Other DBs
NCBI-GeneID: 100790773
NCBI-ProteinID: XP_014620282
Position
12
AA seq 573 aa AA seqDB search
MRWSSFYHTASRVFNDCPSWAKTVVVCSVISSGGLVAYCDAKPEYVNHESKKKKVVVLGT
GWAGTSFLKNMKSNSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRSITRKSGVN
IHFSEAECYKIDNKNNKVYCRASKDKKLGGQEDFSIDYDYLVIAMGGRSNTFNTPGVQEH
AHFLKEVDEALKIRHSVVDLFERASLPSLPVEEKKKLLSFVVVGGGPTGVEFAAELHDFV
LEDMAKLYPSLKDYVKITLLEAGDHILNMFDKRITEFAEQKFARDGIDVRLGSMVVKVGE
NEITAKERASGQVVSIPHGMVVWSTGIGARPEVVEFMKQLGQVNRRALVTDEWLRVEGSD
NIYALGDCATINQRRVMEDIAVIFSKADKNNSGKLDLKEFKDVVGDIIERYPQVDIYLKK
NQMRDMASLLKKSQESNIIVDIEYFKEALSKVDSQMKNLPATAQVAAQQGVYLADCFNRM
EECEKYPEGPLRFRGVGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWISIGQSTQWLWY
SVYTSKQVSWRTRFLVVGDWGRRFIFGRDSSKI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggtcttccttctatcacacggcctcgagggttttcaatgactgtccatcatgg
gccaagactgttgttgtttgcagtgtcatcagtagtggaggtctagtggcatattgcgat
gccaaaccagaatatgttaatcatgaaagtaaaaaaaagaaggtggtggtgcttggaact
ggttgggctggaaccagttttttgaaaaatatgaaaagcaactcctatgatattcatgtt
gtttcaccacgtaactattttgcattcactccattgttaccaagtgtcacgtgtggcaca
gtggaagcaaggagcgtcgttgaaccgattcgcagcatcaccaggaagagcggtgtaaat
attcatttcagtgaagctgaatgctataagatcgataacaagaacaacaaagtttattgc
cgtgctagtaaagacaaaaagttgggtggccaagaagacttttccattgattatgattac
ctggtaatagctatgggaggccgttctaataccttcaacacacctggtgttcaagagcat
gcccatttcttgaaggaagtggatgaagctctaaaaattcgtcattcagtggttgacctt
tttgaaagagctagccttccttctttaccagtggaagagaagaaaaaacttctgagtttt
gtagtagttggtggtggtccaactggggtagagtttgctgctgagcttcatgactttgta
cttgaggatatggcgaagctatatccttcccttaaagactatgtgaagattactctcctg
gaggcaggcgatcatatcttaaacatgtttgacaagagaattacagagtttgctgaacaa
aagtttgctagagatggcattgatgtgaggttgggatctatggttgtcaaagttggtgaa
aacgaaattactgccaaagaaagggcaagtggtcaagttgtttctatacctcatggaatg
gtagtttggtcaactggtattggtgctcgccctgaagtagttgaatttatgaagcagctt
ggccaggttaacaggcgtgcattggtcactgatgaatggctaagggtggaaggatctgac
aacatctatgctctaggtgattgtgctactataaatcaacgtagagttatggaagatata
gccgtgatatttagcaaggctgacaagaacaattctggaaaattagatcttaaagaattt
aaagacgttgttggcgacattattgagagataccctcaagtagacatttatttaaagaag
aaccaaatgagagacatggccagcttgctaaagaaatctcaagagagcaatattatagtg
gacattgaatactttaaagaagccctttccaaagtagactctcagatgaaaaatcttcct
gcaacagctcaggtagctgcacaacaaggagtctatcttgcagactgtttcaaccgcatg
gaggagtgtgagaagtatccagaaggccctctcaggttcaggggagttggacgccatcgg
ttccgtcccttcaggtacaggcatttgggacaatttgctcctctaggaggagagcaaact
gcagctcagcttccaggagattggatttcaattggtcagagcacccaatggctctggtat
tcggtgtatacaagcaaacaagtgagctggaggacaaggtttttggtggttggtgactgg
ggaaggcgattcatatttggcagggactcaagtaaaatctaa

DBGET integrated database retrieval system