KEGG   Glycine max (soybean): 100791456Help
Entry
100791456         CDS       T01710                                 

Definition
(RefSeq) beta-galactosidase 13
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 GHD Gal_Lectin BetaGal_dom4_5 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 100791456
NCBI-ProteinID: XP_003523495
UniProt: A0A0R4J2Z7
Position
4
AA seq 844 aa AA seqDB search
MEERTRSILILMTLLSISIAGGNAGGLQHHKGRHGKHGRHMSARNVTYDGKSLFINGRRE
ILFSGSVHYTRSTPDMWPDILDKARRGGLNVIQTYVFWNAHEPEPGKFNFQGNYDLVKFI
RLVQAKGMFVTLRVGPFIQAEWNHGGLPYWLREVPGIIFRSDNEPYKFHMKAFVSKIIQM
MKDEKLFAPQGGPIILAQIENEYNHIQLAYEEKGDSYVQWAANMAVATDIGVPWLMCKQR
DAPDPVINACNGRHCGDTFAGPNKPYKPAIWTENWTAQYRVHGDPPSQRSAEDIAFSVAR
FFSKNGNLVNYYMYHGGTNFGRTSSVFSTTRYYDEAPLDEYGLPREPKWSHLRDVHKALL
LCRRAILGGVPSVQKLNHFHEVRTFERVGTNMCAAFITNNHTMEPATINFRGTNYFLPPH
SISILPDCKTVVFNTQQIVSQHNSRNYERSPAANNFHWEMFNEAIPTAKKMPINLPVPAE
LYSLLKDTTDYAWYTTSFELSQEDMSMKPGVLPVLRVMSLGHSMVAFVNGDIVGTAHGTH
EEKSFEFQTPVLLRVGTNYISLLSSTVGLPDSGAYMEHRYAGPKSINILGLNRGTLDLTR
NGWGHRVGLKGEGKKVFSEEGSTSVKWKPLGAVPRALSWYRTRFGTPEGTGPVAIRMSGM
AKGMVWVNGNNIGRYWMSYLSPLGKPTQSEYHIPRSFLNPQDNLLVIFEEEARVPAQVEI
LNVNRDTICSVVGERDPANVNSWVSRRGNFHPVVKSVGAAASMACATGKRIVAVEFASFG
NPSGYCGDFAMGSCNAAASKQIVERECLGQEACTLALDRAVFNNNGVDACPDLVKQLAVQ
VRCA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcggactcgcagcattctgattttgatgaccttgctttccatctccattgct
ggcggcaatgcaggtggcttgcagcatcataagggtaggcatggtaagcatggtcgtcat
atgtctgctcgtaatgtgacttacgacggtaagtcactgttcattaacggaaggcgcgag
atccttttttccggctccgtccattacacacgaagcaccccagatatgtggcctgacatt
cttgacaaagcaaggcgcggaggcttgaacgtcattcaaacttacgttttctggaacgct
cacgagccagagcccggcaagttcaacttccaaggcaattatgatcttgtcaagttcatt
aggctcgttcaagccaaaggcatgtttgtcactctcagggttggtcccttcatccaagcc
gagtggaaccacggaggtcttccttattggcttagagaggtccctggcatcatattccgc
tctgacaatgagccctacaagtttcacatgaaagccttcgtgtctaagattatacagatg
atgaaggatgagaagctctttgctccccaaggaggtcccatcatcttggctcaaattgag
aacgagtacaatcatatccaacttgcatacgaagagaagggagacagttacgtccaatgg
gctgccaatatggccgtggccaccgatattggtgttccatggctcatgtgcaagcagagg
gatgcccctgatcccgtcatcaacgcatgcaatggtagacactgtggtgataccttcgca
gggccaaacaaaccatacaaaccagccatatggaccgagaattggactgctcagtacaga
gtacatggagatccaccatcccagagatccgcagaagacatcgcattctcagttgcccgt
ttcttctccaagaatggaaatttggtcaactactatatgtaccatggtggaacaaacttt
ggcagaacaagctctgtgtttagcacaacccgttattacgatgaggcacctcttgatgaa
tacggtctgcccagagaaccgaaatggagtcacctgagggacgtgcacaaagctttgctc
ctttgcaggagggctatccttggtggcgttcccagtgtccaaaagttgaaccattttcac
gaggttagaacctttgagagggttggaaccaacatgtgtgctgctttcatcactaacaac
cacaccatggagccagccaccattaacttcagaggcacaaactactttttgcctccacat
tccatcagcatcctccccgattgcaagaccgtggtcttcaacacccaacagattgtttca
cagcacaattcaaggaactacgagaggtcacccgcagccaacaatttccactgggagatg
ttcaatgaggccattccaacggccaagaaaatgccaatcaacctcccagttcccgcagag
ctttacagcttgcttaaggacaccaccgactatgcttggtacaccaccagcttcgagttg
agtcaagaagacatgtcaatgaagcccggggtacttccagtacttcgtgttatgagtctc
ggacattcaatggttgcattcgtaaacggagacatcgttggaactgctcatggtacccat
gaagaaaaatcttttgagttccagacacctgtattgctcagggttggaaccaactatatt
tccttgttgtctagcactgttggactacccgacagcggagcttacatggaacataggtac
gcaggacccaagtccataaacatccttggtctcaacagggggacactagatcttactcgc
aatgggtggggtcatcgggttggtctgaaaggtgagggcaagaaagttttcagcgaggaa
ggatcaacaagtgtaaagtggaaaccacttggtgcagttccgagggctctgagctggtac
aggacaagatttggcaccccagagggaacaggccctgttgccataaggatgagtggtatg
gcgaagggaatggtgtgggtcaacggtaacaacattggtcgctactggatgagttacctc
tctccacttggaaagcctactcaatcagagtaccacatcccaagatctttcctgaaccca
caagacaatttgcttgtgatttttgaagaggaggccagagttccagcacaggttgagatc
ctaaatgtgaacagagacacaatctgcagcgtagttggagagagggaccctgcgaacgtg
aattcatgggtgtctaggaggggcaatttccatcctgtagtgaaatcagttggagcagca
gcttcgatggcgtgtgcaactgggaaaaggatagtggcagtggagttcgcaagctttgga
aaccccagtggttattgcggagactttgcaatgggaagctgcaatgctgctgccagcaag
caaatcgtggagcgagaatgcttagggcaagaagcttgcacgcttgcattggaccgtgcg
gtgttcaacaacaatggcgtggatgcttgcccagatttggtgaagcaacttgcagtccaa
gtgaggtgtgcttag

DBGET integrated database retrieval system