KEGG   Glycine max (soybean): 100793318Help
Entry
100793318         CDS       T01710                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00250  Alanine, aspartate and glutamate metabolism
gmx00650  Butanoate metabolism
gmx01100  Metabolic pathways
Module
gmx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100793318
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100793318
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     100793318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 100793318
NCBI-ProteinID: XP_003532910
UniProt: I1KTW3
Position
8
AA seq 537 aa AA seqDB search
MAALNLCRMALRSSKLLYRPYNLLSVQLQMQMQPSSPPLTRKMSTDAQSIASQLNSSGLL
RTQGLIAGKWSDAYDGKTIKVYNPATGESVVDVACMGGRETNDAISAAYDAYGSWSKTTA
AERSKLLRKWYDLLMVHKEELAQLITLEQGKPLKESVGEIVYGAGFIEFAAEEAKRIYGD
IVPAPFSDRRLFVLKQPVGVVGAITPWNFPLAMITRKVGPALACGCTVVIKPSELTPLTA
LAAVELSIQAGIPPGVVNVVMGNAPDIGDALLASPQVRKITFTGSTAVGKKLMAGSAETV
KKVSLELGGNAPCIVFDDADLDVAVKGTLAAKFRNSGQTCVCANRIIVQEGIYEKFANAL
RDAVQNMKVGDGFSEGVSQGPLINEAAVKKVESLIHDATSKGAKVILGGKRHSLGLTFYE
PTVISDVNSDMHISREEAFGPVAPLLRFKTEEEAIRIANDTNAGLGSYVFTNSIQRSWRV
AEALEYGLVGVNEGVISTEVAPFGGFKQSGLGREGSKYGMDEYLEIKYVCFGNMNKE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggccgcactgaacctttgccgcatggcacttcgatcctcgaaacttctctatcgccct
tataatcttctctccgttcagttgcagatgcagatgcaaccctcttctcctcccctcact
cgaaagatgagcacggatgcgcagagtattgcttcccagcttaatagttctggattgttg
aggactcagggccttattgcagggaaatggagtgatgcttatgatggtaaaaccataaag
gtttataatccagcaactggtgaatctgttgtagatgttgcatgcatgggtggaagagag
acaaacgatgcaatttctgcagcctatgatgcatatggatcttggagcaaaaccactgct
gctgaacgaagcaaattactgaggaaatggtatgatttgctaatggtacataaagaagaa
cttgcacagcttataaccttggagcaggggaaacctcttaaagagtctgtgggtgagata
gtctatggggctggctttattgagtttgcagctgaggaggcaaaacgtatatatggggat
atagttcctgcacctttttctgatcggcgattatttgttctaaagcagcctgtaggggtt
gtaggtgcaattacaccttggaactttccccttgctatgattactcgaaaggttggtcca
gcccttgcatgtggctgtacagtggtcataaagccctctgaacttacacctctcactgct
ttagctgcagtggaactctccattcaagctggaataccaccgggtgtcgtgaacgtggta
atgggaaatgctcctgatattggggacgctttacttgcaagtccacaggtaaggaagatc
acattcacaggctcgacagcagttgggaagaaattgatggctggttcagctgaaacagtt
aaaaaagtatctcttgaactcggtggcaatgcaccttgcatagtttttgatgatgctgac
ctggatgttgcagtaaaaggaactcttgcagcaaagttccgtaacagtggacaaacatgt
gtttgtgcaaatagaattattgtgcaagaaggtatatatgagaagtttgcaaatgcttta
cgtgatgctgttcagaatatgaaagttggggatggttttagtgaaggtgtgtcacagggt
cctctaataaatgaagctgctgtaaaaaaggttgagtccttaattcatgatgctacatcg
aagggagcaaaagtaattcttgggggtaaaagacatagccttggacttactttttatgaa
cccacagtcatcagtgatgtcaacagtgatatgcacatatcaagagaggaagcatttgga
cctgttgcaccccttttgagattcaaaactgaagaggaagctatcagaattgctaatgac
actaacgcaggtttgggttcatatgtatttacaaacagtatccaacgatcatggcgtgtt
gctgaggctcttgaatatggactagtgggtgttaatgaaggagtaatttcaactgaggtg
gctccatttggtggttttaaacagtctggccttggaagagaaggctccaaatatgggatg
gatgaatatttagagatcaagtatgtgtgcttcggaaacatgaacaaagaatga

DBGET integrated database retrieval system