KEGG   Glycine max (soybean): 100793684Help
Entry
100793684         CDS       T01710                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP62
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gmx03110]
    100793684
Enzymes [BR:gmx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100793684
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    100793684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 FKBP_N_2 TPR_8 TPR_19 TPR_9
Motif
Other DBs
NCBI-GeneID: 100793684
NCBI-ProteinID: XP_003550301
UniProt: K7MNJ9
Position
17
AA seq 583 aa AA seqDB search
MVVLLSEEDEFDEEPGEVVDSAPPQKVGEEREFSGFKKKLFKPGQGLEFPNFDDVVTVRC
VGIGTLLDGTTFDSTRERDQPRTFALGKDDIGAGLDRAIITMKKGEVALFTLPGDGGDGD
VSLDSDDSSAVRFEVELVSWITVVDVCKDGGVVKKILEKGSGIERPGDLDEVLVKYRVVL
GDGTVVVETLEGGVEFHMKDGHLFPILPKVIMTMTRGEKAELILQPQYAFGEKGREAGSG
LCSIPPNSVLHVNIELVSFKPVINVTGDSKVIKKILKEGEGAFTANEGANVTVSFTAMLE
DGTVFEKRGIGETLPLEFITDEEQVITGLDRAVATMKKGERAIISIHPDYAFGDVEVRRD
IAIVPPGSNVVYDIEMMDFIKEKAPWELNSKEKIEVAGRMKEEGNVLFKVGNYQRAGKKY
EKAADFVDEDGSFGFDEQKQAQTLKVSCWLNSAACSLKLNDFPGAIKLCSQVLDVEFCNV
KAFYRRAQAYIETGDYLLADVDIKKALVVDPQNRDVKVIQKKLKQLQADSDKKDAKLYEN
MLARKTKDPSMAIKRLKVEKDQGENEEVARMEIDEVADSAVIQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgctgttgtcggaggaggatgaattcgacgaggagcccggcgaggtagtggat
tcagcgccgccgcagaaggtcggcgaagagagagaattcagtggtttcaagaagaagctt
ttcaaacccggacagggattggaattccccaacttcgacgacgtcgtaactgttcgctgt
gttggaattggaacattgctcgatggaacaacgtttgattccactagggagagggatcaa
cctaggacgtttgctcttggaaaagatgacattggtgctggtttggaccgtgccattatc
actatgaagaaaggggaggtggcattgttcacgttgcccggagatggtggtgatggcgat
gtttcgcttgattccgacgactcttcggctgtgcggtttgaggtggagctcgtttcgtgg
atcacggtggtggatgtttgcaaagatggtggagttgtcaagaaaattctggagaagggg
agtggcattgagcgccctggtgatcttgatgaagtgcttgtaaagtatcgggtggtgctt
ggtgatggcactgttgttgtggagacgctggaaggaggagttgagtttcacatgaaggat
ggtcatctttttcctatattgccaaaagtaatcatgactatgacaaggggagagaaggct
gaattaattctccaaccccagtatgcctttggggagaaggggagagaagctggcagtggg
ctctgttcaattcctccgaattcagtgctgcatgttaatattgaattggtgtccttcaag
cctgtcataaatgttactggtgactccaaggtgattaaaaagattttgaaagaaggggag
ggtgctttcacagccaatgaaggtgcaaatgttactgtgagcttcacagctatgctagaa
gatggcactgtatttgagaaaagaggaattggtgaaacactacccttggaattcataact
gatgaggaacaagtgattactggtctagaccgagctgtggcaacaatgaagaagggtgag
agggcgataattagcatacatcctgattatgcatttggagatgttgaagtgagacgagat
attgctattgtgccaccgggctcaaatgtagtctatgacattgagatgatggattttatt
aaggagaaagcaccatgggaattgaatagtaaggagaaaattgaggtggctgggaggatg
aaagaagaaggaaatgtattatttaaagttggcaattatcagcgagcaggaaagaaatat
gaaaaggctgctgattttgttgatgaagatggatcctttgggtttgatgagcaaaagcaa
gctcagacactgaaagtgtcatgctggttgaatagtgcagcttgtagccttaaacttaat
gactttcctggagcaatcaagctatgttcacaggtgcttgatgttgaattttgcaatgtg
aaagctttttacagacgagcacaagcatatatagaaactggagattatcttttagcagat
gtagacatcaagaaagctcttgtggtggacccacaaaacagagatgttaaggtaattcag
aagaaattgaagcaacttcaagctgacagtgacaaaaaagatgctaagctatatgaaaac
atgcttgcacgtaaaacaaaggacccatctatggctataaagagattgaaggtagagaaa
gatcagggggaaaatgaagaggttgcaagaatggaaattgacgaagttgctgatagcgca
gtgattcaatag

DBGET integrated database retrieval system