KEGG   Glycine max (soybean): 100795007Help
Entry
100795007         CDS       T01710                                 

Definition
(RefSeq) 4-alpha-glucanotransferase, chloroplastic/amyloplastic
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100795007
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100795007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-GeneID: 100795007
NCBI-ProteinID: XP_003526830
UniProt: I1KBB6
Position
6
AA seq 568 aa AA seqDB search
MALLALNISVCCFQQQRSPTLFKPTITKQTLSLPTASAFSSSSLTQLSVGQYLPANYGDW
VPNPDPELRRRCGILLHPTSFRGPYGIGDLGDEAFRFIDWLHHSGCSVWQVLPLVPPGRK
ANEEGSPYSGQDANCGNTLLISLQGLVEDGLLEKHELPQPIDAERVNFSLVADVKDPLIT
KAAERLISSEGELKTQLENFRRDPDISSWLEDAAYFAAIDDSLNTISWYNWPEPLRNRHL
VALEDIYQQKRDFINVFIAQQFLFQRQWQKVHSYAQSKGISIMGDMPIYVGYHSADVWAN
KKQFLLNRKGFPLLVSGVPPDAFSETGQLWGSPLYDWKAMEKDGYSWWVRRIRRAQNLFD
EFRIDHFRGFAGYWAVPSEAKVAMLGKWKVGPGISLFDTIFRAVGRINIIAEDLGVITED
VVQLRRSIGAPGMAVLQFGFGGDANNPHLPHNHECNQVVYTGTHDNDTIGGWWEVLNQEE
KSNVLRYLSLNEGDDIPWALIQRVLASVAQTAIIPMQDVLGLGNSARMNIPATQFGNWGW
RIASSVSFDGLEREADRLREMLSMYGRL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctggcattgaacatctcagtgtgttgtttccaacagcagcgttcccccact
ctcttcaaacccaccattaccaaacaaaccctctccctccccaccgcttccgctttctct
tcctcttccttaactcaactcagcgtgggccaatatttacccgccaactacggcgattgg
gttcccaaccccgacccggagcttcgcagaagatgcggcattctgctccatccgacgtcg
tttcgcggcccctacggaattggcgatcttggcgacgaggccttccgtttcatcgactgg
ctccaccactcgggttgctccgtttggcaggttcttcccctcgtgccacctggcagaaag
gccaacgaagaaggatccccttactctggccaggatgcgaattgtggcaacacgctcttg
atctctcttcaaggcctcgtcgaggatgggttgttggaaaaacacgagcttcctcaacca
attgatgcagagcgcgtgaatttttcacttgttgctgatgttaaggatcctttgataact
aaggctgcagagaggctcatttcaagtgaaggggaactcaaaacacagcttgagaatttt
cgtcgggaccctgacatatcaagctggcttgaagatgcagcctattttgctgctattgac
gacagtttaaacacaatcagctggtacaattggcctgaacctttaagaaatcgccatctt
gtagctctagaagatatttaccaacaaaagcgagattttataaatgtatttattgcccaa
cagttcttgtttcaaaggcagtggcagaaagttcacagctatgcacagagtaagggaatc
agcataatgggagacatgccaatatatgttggttatcatagcgcagatgtttgggcaaat
aagaaacagtttttactgaacaggaagggctttcctcttttagttagtggtgttcctcct
gacgcattcagtgaaaccggccagctctggggcagccccctgtatgattggaaagccatg
gagaaagatggatactcgtggtgggtacgtcgcatacgacgtgcacaaaatttatttgat
gaatttaggattgaccactttagaggatttgcaggatattgggctgttccctctgaagca
aaagtagctatgcttggaaagtggaaggtaggacctggaatatccttatttgataccatt
ttcagagctgttggaaggattaatattatagcagaagacttgggagttatcactgaggat
gtagtccaactaagaagatccattggagcacctggaatggctgttctccaatttgggttt
ggaggtgatgctaataaccctcatttgcctcataatcatgagtgcaatcaagttgtctat
acagggactcatgacaatgacacaattggaggttggtgggaagttttgaaccaagaagag
aaatccaatgtactacgttatctttcattaaatgagggagatgacattccatgggcgcta
atccagagagtattggcttctgttgctcaaacagcaataatacctatgcaagatgttctt
ggattgggtaattctgccaggatgaatattcccgcaactcagtttggaaactggggttgg
agaattgcaagttcggtgagctttgatggcttggagagagaggcagacagactcagagaa
atgctttcaatgtatggccgactttga

DBGET integrated database retrieval system