KEGG   Glycine max (soybean): 100795274Help
Entry
100795274         CDS       T01710                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00350  Tyrosine metabolism
gmx00360  Phenylalanine metabolism
gmx00380  Tryptophan metabolism
gmx00950  Isoquinoline alkaloid biosynthesis
gmx00965  Betalain biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100795274
   00360 Phenylalanine metabolism
    100795274
   00380 Tryptophan metabolism
    100795274
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    100795274
   00950 Isoquinoline alkaloid biosynthesis
    100795274
   00965 Betalain biosynthesis
    100795274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmx04147]
    100795274
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100795274
    4.1.1.105  L-tryptophan decarboxylase
     100795274
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100795274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DUF1148 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100795274
NCBI-ProteinID: XP_003535055
UniProt: I1L0D0
Position
9
AA seq 498 aa AA seqDB search
MTMNPLDPQEFRRQGHMIIDFLADYYQNIANYPVLSHVEPGYLRELMPSFAPLNPEPIET
ILRDLQQHIVPGITHWQSPNYFAYFPSSGSTAGFLGEMLSTGFNLVGFNWVSSPAATELE
SIVMEWLGQVLKLPKAFLFSGSGGGVLLGTTCEAILVTLVAARDKVLSQIGRENICKLVV
YVSDQTHCAVQKAAHIIGILPKNIRVVKTMKSTSFTLLPESLVSSIHTDVQKGLVPCYLC
ATVGTTSTTAIDPLGPLCKVAKEYGMWVHVDAAYAGSACICPEFRHLIDGVEGANSFSLN
AHKWFLTNLDCCCLWVKDPASVIKSLSTNSVYLENSASDSNQVVDYKDWQITLSRRFRAL
KVWLVLRSYGVANLRNFLRSHVEMAKTFEGLVRMDKRFEIFVPRNLAVVCFRILPCAVAR
IGNGRVQNGYLTTEDAANEINRKLLDSINGSGLVYMTHAIVGGAFVIRCAIGATLTEKTH
VIMAWKVVQEHADTILNH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaaccctttggatccacaagaattcaggaggcaagggcacatgatcattgac
ttccttgctgattattaccagaacattgccaactatccagtgttgagccatgtagaacca
ggttatcttagagaactcatgccatcttttgcacctctcaaccctgaaccaattgaaacc
atccttcgagatttgcagcagcacatagtccctggcataacacactggcaaagccctaat
tactttgcttactttccctccagcggtagcacagcagggtttcttggtgagatgctgagc
acagggttcaacttggtagggttcaattgggtgtcttcaccagcagcaacagaattagaa
agcattgtcatggagtggctaggtcaggttctgaagctcccaaaggcttttctcttttca
ggtagtggtggaggtgtgctgctaggtacaacatgtgaggccattttggtcacactagtt
gctgctagggataaagtacttagccaaattggtagagaaaatatttgcaagcttgttgtt
tatgtctctgatcaaacacattgtgctgtacagaaagcagctcatataataggaattctc
cccaaaaatattagggttgtcaagactatgaagtcaacttcattcactttgttgccagag
tcactggtatcttccattcacacagatgttcaaaaaggattggttccttgttatctttgt
gccactgtgggaacaacttcaaccactgcaattgatccattaggaccactgtgcaaggtg
gcaaaagaatatggcatgtgggtccatgttgatgctgcttatgctggaagtgcatgcatt
tgtcctgagttcagacacttgattgatggagttgagggtgcaaactctttcagtctcaat
gctcacaagtggtttctcactaacttagattgttgctgtctttgggtgaaggatccagct
tctgtgattaagtccctatcaacaaattcagtgtacttagaaaacagtgcttctgattca
aatcaagtggtggactacaaggactggcagataaccttgagcagaagattccgtgcactc
aaagtttggcttgttctgagaagctatggtgttgctaatctcagaaacttcctcagaagc
cacgttgaaatggctaagacttttgaagggttggtaagaatggataagaggtttgagatt
tttgtgcctagaaatcttgctgtggtttgctttaggattttaccttgtgcagttgcaagg
attggtaatggtagggtccaaaatggatatctaacaactgaggatgctgcaaatgaaatc
aaccgcaaattgcttgattcaataaatggttcaggacttgtgtacatgactcatgcaatt
gttggaggggctttcgttattaggtgtgccataggagcaactttaactgagaaaacacat
gtcatcatggcctggaaagtggtgcaggaacatgcagatacaattctaaaccattaa

DBGET integrated database retrieval system