KEGG   Glycine max (soybean): 100795956
Entry
100795956         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100795956
Organism
gmx  Glycine max (soybean)
SSDB
Motif
Pfam: DUF3496
Other DBs
NCBI-GeneID: 100795956
NCBI-ProteinID: NP_001242080
UniProt: C6TGX3
Position
9
AA seq 464 aa
MVLTSISIVSSSSSFLSDSPSTSSPTTRIRPFFFHSSNRAPLFVFPRAHLPSATLRASSS
SVSTPHENGSPEQFLKSNSIADFMRFKRRVDGGASAELQTALVSYRKRFPWSLLRPFLQV
DLVSTIHIADEEYFPALQKELESYDCVLYEMVASRESLENRRNATNTKRLKSSRTRGFNI
LGCIQRQMARILTLDFQLDCLNYESSNWYHADLDYETFKLLRLEKGESFFSFAKDMTLKS
TKAVLQPASIPEDLDPLRSKLLWASRVLPMPLVGLLIIGGVCTDVGTQASEYPEIEALSR
LDFGAALKVFLAKRLTSEFTLVTADVEEKSVIIGERNRVAIEALRAAMDKGHNKIAILYG
GGHMPDLGRRLREDFDLVPSNVQWITAWSITKKDLNTDSFPFLKTIAKASGWPLNRYQTL
ALPIFSSVLALDLWFWELFFGTAVNWVSELGSELLRYVDNSPMI
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggtgctaacttcaatttcaatagtctcttcttcatcttcattcctctcagattctcct
tccacttcttcccctaccaccagaatcagaccattcttcttccattcctccaaccgagcc
cctctttttgtgttccccagagcacaccttcccagtgctaccctcagagcctcttcttct
tccgtttccacgccgcatgaaaatgggtcgccggaacagttcttgaagagcaattccata
gccgatttcatgcggttcaagcgcagggtcgatggtggtgccagtgccgagttgcagact
gctcttgtcagctacaggaagaggttcccttggtcccttttgcgccctttccttcaggtt
gacttggtttccacaattcacatcgctgatgaagagtattttccggccctccaaaaggaa
ctcgagagctatgattgtgtcctttacgaaatggtagctagcagggaaagtttagaaaat
agaagaaatgctactaatacaaaaaggttaaaaagttcacgcacaaggggttttaacatt
ttgggatgcatccaaagacagatggctcgaattcttacacttgatttccaattagattgt
ctcaattatgagtcttcgaattggtaccatgcagatcttgattatgagaccttcaaatta
cttcggcttgaaaaaggtgaaagcttcttttcttttgcaaaagatatgactcttaagtct
acaaaggcagtattgcagccagcttcaattccggaagatcttgacccgttgagatccaag
cttttatgggcttcacgtgtacttcctatgccacttgttggccttcttatcattggaggt
gtttgtacagatgtgggaactcaagcatcagaatatcctgaaatagaggcactgtcaagg
cttgattttggtgctgccttgaaggtcttcctcgcaaagagacttacatctgagttcaca
ctggtgacagcagatgtagaggagaaatcggttataattggtgagagaaatagagtagca
atagaggccctgagagcagcaatggacaagggacacaataaaattgcaatactatatggg
ggtggccacatgccagatcttgggaggagattgagggaggattttgatttagtcccatct
aatgtacagtggataacagcttggtccataacgaaaaaggacctaaatactgattcattt
ccatttctgaagacaattgctaaggcctcaggctggccattgaaccgctatcagaccttg
gcattgcccatcttttcatcagtcttagcattggatctgtggttctgggagctcttcttt
ggcactgcagtgaattgggtttctgaacttggctcagaacttcttcggtatgttgataat
tcaccgatgatatga

DBGET integrated database retrieval system