KEGG   Glycine max (soybean): 100796687Help
Entry
100796687         CDS       T01710                                 

Definition
(RefSeq) SNF1-related protein kinase catalytic subunit alpha KIN10
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100796687
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100796687
Membrane trafficking [BR:gmx04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100796687
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100796687
  Mitophagy factors
   Other mitophagy factors
    100796687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 Kinase-like AdenylateSensor UBA RIO1 UBA_2 UBA_3 Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 100796687
NCBI-ProteinID: XP_003552545
UniProt: I1N4G7
Position
18
AA seq 514 aa AA seqDB search
MDGPAGRGGAGLDMFLPNYKLGKTLGIGSFGKVKIAEHVLTGHKVAIKILNRRKIKNMEM
EEKVRREIKILRLFMHPHIIRLYEVIETPTDIYVVMEYVKSGELFDYIVEKGRLQEDEAR
NFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSP
NYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHL
SPGARDLIPGMLVVDPMRRMTIPEIRQHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQE
VVKMGFDRNQLVESLGNRIQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMDSGFNQMHSS
ELASSVVGNRFPGYMEYPGVGSRQQFPVERKWALGLQSRAHPREIMTEVLKALQELNVCW
KKIGHYNMKCRWVAGIPGHHEGMVNNNVHSNHYFGDDSNIIENDAVSTSNVVKFEVQLYK
TREEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggatggaccagctggccgaggtggtgctggcctggacatgtttctaccaaattataaa
ttgggaaaaacactcgggattggatcttttggcaaggtgaaaattgcagaacatgtgttg
actggccataaggttgcgatcaagatccttaaccgacgcaagataaagaacatggaaatg
gaagaaaaagtgagaagagaaatcaaaattttaagattgttcatgcatcctcacattatt
cgactttatgaagtcatagaaactccaactgacatatatgttgtcatggagtatgtgaag
tctggagagcttttcgattacatagtagagaagggtaggttgcaggaagatgaagctcgt
aatttttttcagcagataatctctggggtggagtactgtcacaggaatatggtggttcat
agagatttgaagcctgagaatttacttttggactccaaatgtaatgtcaagattgctgat
tttggcttgagcaacatcatgcgtgatggtcactttcttaaaacaagttgtggaagccct
aactatgcagctcctgaggttatctctgggaaattgtatgctggacctgaagtggatgtc
tggagctgtggtgtaattttatatgcccttctttgtggcacccttccttttgatgatgaa
aatattccaaatctcttcaagaaaataaagggtgggatttacactcttcccagtcatcta
tcacccggtgctagagatttgataccagggatgcttgtggttgaccctatgaggagaatg
accatacctgagatccgtcaacacccatggttccaagctcgacttccacgttatttagct
gtgccaccaccagatacaatgcaacaggccaaaaagattgatgaggagatccttcaggaa
gtggtgaaaatgggatttgacaggaatcaattggttgaatctcttgggaacaggatacaa
aatgagggtactgtggcatactatttgttattggacaaccgatttcgtgtttccagtggc
tatcttggagctgagtttcaagagaccatggattccggttttaatcaaatgcattccagt
gaacttgcttcttcagttgttggaaaccgctttccaggctacatggaatatccaggagta
ggatcgaggcaacagttccctgttgaaaggaaatgggcccttgggcttcagtctcgagcc
catcctcgtgaaataatgactgaggttcttaaagctttgcaagaattaaatgtttgttgg
aagaagattggtcactacaacatgaagtgtaggtgggttgctggcattcctggtcaccac
gaaggaatggttaacaataatgtgcatagtaatcattactttggagatgattccaacatt
attgagaatgatgctgtttctacttcaaatgtggtcaagtttgaagtgcagctttacaaa
acccgggaagaaaagtatctgcttgatcttcaaagggtgcagggtccacagtttcttttc
ttggatctatgtgctgctttccttgcacagcttcgtgtcctctag

DBGET integrated database retrieval system