KEGG   Glycine max (soybean): 100797111Help
Entry
100797111         CDS       T01710                                 

Definition
(RefSeq) GPI transamidase component PIG-T-like
  KO
K05292  GPI-anchor transamidase subunit T
Organism
gmx  Glycine max (soybean)
Pathway
gmx00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100797111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 DUF4914
Motif
Other DBs
NCBI-GeneID: 100797111
NCBI-ProteinID: XP_025980823
Position
13
AA seq 222 aa AA seqDB search
MGSGNERGAIAISLKSIQGLVAINNVKERCKLQANVLQIVPWYVKVYYHTLQLVVDESPQ
ALTDFVERMRVSPSEDKVSPWVMEMILQFPCEMKSAVLSIVFDKGFLHIDEYPPDVNQGF
DIPSAIISFPDFHAGLQLSNKSRSKSPLLSKLQEKSLLLSYTELLLVPLMTPDFSMPYNV
ITISCTVFALYFGSLLNVLRRGGKTFEKQRCKQSSVPSLSAI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgggaatgaaaggggtgctattgcaatatccttgaaatcgatccagggactt
gttgcaatcaataatgttaaagagaggtgtaagttgcaagctaatgttctccaaattgtg
ccttggtatgtcaaggtatattatcatactttgcaattagtagttgatgaaagtcctcaa
gcactcacagattttgttgagagaatgcgtgtttcgccttccgaagacaaagtatcaccc
tgggtgatggagatgattcttcaatttccttgtgaaatgaagtcagctgtattgagtata
gtgtttgataagggcttcttacacattgatgaataccctccagatgttaatcaaggattt
gacattccatcagcaataataagctttcctgacttccatgctggtttgcaattgtctaat
aaatctcgaagcaagtcaccactgttgtctaagttacaggaaaaaagtcttcttctctct
tacacagaacttttacttgtacccttgatgactcctgatttcagtatgccatacaatgtc
atcacaatttcatgtacagtttttgctttgtattttggatcattgctaaatgttctccgg
agaggaggaaagacttttgaaaaacaaagatgcaagcaaagtagtgttccttcactgagt
gctatctaa

DBGET integrated database retrieval system