KEGG   Glycine max (soybean): 100798935Help
Entry
100798935         CDS       T01710                                 

Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00600  Sphingolipid metabolism
gmx01100  Metabolic pathways
Module
gmx_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100798935
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100798935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat NYN
Motif
Other DBs
NCBI-GeneID: 100798935
NCBI-ProteinID: XP_003530986
UniProt: I1KQP5
Position
8
AA seq 486 aa AA seqDB search
MDRPAAIFSDTVNLNGTVTQLSLLADGRLWWPEGGQRNLSIEKEVLGFTGDGPDIRLKTI
VETEDGCCGGASRAKLVRNDVVFRPSSEETHRLWCQKLGEFIDSLGRPKRLFVFVNPFGG
TKSAVIVFRDQVKPLLEDAQVQLTVQETKHQLHAKQVVQSLDFSKYDGIVCVSGDGILVE
VVNGLLQRQDWDTAIKMPLGVVPAGTGNGMAKSLLDSVGDPCTVPNAVLAIIRGRKRKLD
VATITQGETRFFSVLMLAWGLVADIDIESEKYRWMGSARIDFYALTRILHLRHYIGCLYF
VPAPGFEAYGDPTSYPGSSNNKGSNSELIDEEPLKLQRLGYQGPEIDLENQSWRVLNGPF
ISVWLHNVAWGAENTKAAPDAKFSDGYLDLIITKNCPKLPLLSLMSDLNNGGHVKSPYVM
YLKVKVLVLEPGPRLGDQEKEGIIDADGEVLARGKGSYQCEQKALMAYDKLQITVDQGLA
TIFSPI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccgccgccatattttccgacaccgtcaacctcaacggcacggtgacgcag
ctgtctctgctcgccgacgggaggctgtggtggccggagggcggtcaacgcaatttgagc
atcgagaaagaggttctcgggttcaccggcgacggtcccgatataaggctcaaaacaatc
gtggaaaccgaagatggatgctgtggcggtgcaagcagagcaaaactagtccgaaacgac
gtcgtttttcggccatcgtccgaggaaacgcataggctctggtgccagaagcttggcgaa
ttcatcgattctctcggacgacccaagaggctttttgtttttgttaatccattcgggggg
acgaaatctgctgtcattgtttttcgtgatcaagtcaagcctctgcttgaagacgcacaa
gtgcagcttacagtccaagaaactaagcatcagctccacgcaaagcaagttgttcagtca
ttagatttttcaaagtacgatgggattgtttgtgttagtggagatgggatcttggtcgag
gttgtaaatggactgcttcagaggcaggactgggacactgcaattaagatgccccttgga
gtagttcctgcaggtacgggaaatggcatggcaaagtctcttcttgattcagttggtgat
ccttgtacagtacccaatgctgttcttgccatcatacgaggccgtaagcgaaaacttgat
gtggccaccatcacacaaggggagaccagatttttcagtgtgttgatgcttgcatggggt
ctggttgctgatattgatatcgagtctgaaaagtataggtggatgggaagtgctcgtatt
gatttttatgctctcactcgaatcttgcatttgaggcattacattggatgtctttatttt
gtgcctgcacctggatttgaagcttacggggaccccactagttaccctggaagttctaat
aacaaaggcagcaatagtgaactaattgatgaggaacctttgaagttacaaaggctaggc
tatcaaggacctgaaattgacctggagaatcagagttggagagttttaaatggaccattt
atttctgtctggcttcacaatgtggcttggggtgctgaaaacaccaaggcagcaccagat
gcaaagttctcagatggttatctggacttgatcattacgaagaattgcccaaagttacca
ttgctgtcgttgatgtcagatttgaataatggaggtcatgtaaaatcaccatatgtcatg
tatttaaaggtgaaagttttggtcttggaacctggtccacgcttgggggaccaagagaag
gaagggatcatagatgcagatggtgaggttctggcaagggggaaagggtcgtaccaatgt
gagcagaaggctttgatggcctatgataaacttcaaataacagtagatcaaggtttagct
actattttttctccaatataa

DBGET integrated database retrieval system