KEGG   Glycine max (soybean): 100799358Help
Entry
100799358         CDS       T01710                                 

Definition
(RefSeq) triosephosphate isomerase, chloroplastic-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00051  Fructose and mannose metabolism
gmx00562  Inositol phosphate metabolism
gmx00710  Carbon fixation in photosynthetic organisms
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
gmx01230  Biosynthesis of amino acids
Module
gmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gmx_M00002  Glycolysis, core module involving three-carbon compounds
gmx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100799358
   00051 Fructose and mannose metabolism
    100799358
   00562 Inositol phosphate metabolism
    100799358
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100799358
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100799358
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100799358
  Exosomal proteins of bladder cancer cells
   100799358
  Exosomal proteins of melanoma cells
   100799358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100799358
NCBI-ProteinID: NP_001240895
UniProt: C6T7V6
Position
3
AA seq 309 aa AA seqDB search
MAATSTSLASQLYIGLRRPCLKLDSFNSQSFSLFDPNLRLSLSPPKPSRAVIAMAGTGKF
FVGGNWKCNGTKDSISKLVADLNNAKLEPDVDVVVAPPFLYIDQVKNSLTERIEISAQNS
WVGKGGAFTGEISAEQLKDLGCKWVVLGHSERRHVIGENDEFIGKKAAYALSQGLGVIAC
IGELLEEREAGKTFDVCFQQLKAYADAVASWDNIVIAYEPVWAIGTGKVATPQQAQEVHV
AVRDWLKKNVSDEVASKTRIIYGGSVNGGNSAELAKQEDIDGFLVGGASLKGPEFATIVN
SVTSKKVAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaacctcaacatcactggcttctcaactctacattggcctgcgccgcccctgc
ctcaagctcgattctttcaattctcaatctttctctctcttcgaccctaatcttcgccta
tccctctctccacccaaaccctcacgcgccgtcatcgccatggccggcaccgggaagttc
tttgttggtggcaactggaagtgtaacggaacaaaagactcaatcagcaagcttgttgct
gacttgaacaatgcaaaattggagcctgatgttgatgttgtcgttgcacctcccttcctc
tacatcgatcaagtgaaaaactcactcactgagcggattgaaatatctgcccagaattct
tgggttggaaaaggtggtgcttttactggagaaatcagcgcggaacaactaaaagatctt
ggatgcaagtgggttgttcttggacattctgagcgaagacatgttattggagaaaatgat
gagtttatagggaagaaagctgcctatgctttgagccaaggtcttggggtgattgcatgc
attggagaattgttagaagaaagggaggctggaaaaacttttgatgtttgttttcagcaa
ttgaaggcttatgcagacgcagttgctagttgggacaacattgttattgcatatgaacct
gtatgggccattggaacgggcaaagtggccactccccaacaagctcaggaagtacatgta
gctgttcgggattggctaaaaaagaatgtctcagatgaagttgcgtctaaaacacgaatt
atttatggagggtctgtaaatggaggcaacagtgctgaactggcaaagcaagaagatatt
gatggatttctcgttggaggtgcttcattaaagggtcctgagtttgctaccattgtcaat
tcagtcacatccaagaaagttgcggcttaa

DBGET integrated database retrieval system