KEGG   Glycine max (soybean): 100799660Help
Entry
100799660         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100799660 isoform X1
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00460  Cyanoamino acid metabolism
gmx00500  Starch and sucrose metabolism
gmx00940  Phenylpropanoid biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100799660
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100799660
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    100799660
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     100799660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 100799660
NCBI-ProteinID: XP_006575402
UniProt: I1JHB3
Position
2
AA seq 622 aa AA seqDB search
MTEERSSLRGTLHLQYMDCLYMNPQESIEARVKHLLSLMTLNEKIGQMTQIERSVATPSA
IKHFSIGSVFSAPHNGRFEKVLSSDSADMVDGFQKLALESRLAIPIIYGVDAIHGNNSVY
GATIFPHNVGLGATRDQDLVQRIGAATSLELRASGIHYTFAPCVAVCKDPRWGRCYESYS
ENTEIVREMTSFVLGLQGNPPERHPRGYPFVAGRNNVVACAKHFVGDGGTEKGVNEGNTI
LSYEDLERIHMAPYVDCIAKGVSTIMVSYSSWNGNKLHGHHFLLNEILKEKLGFKGFVIS
DWEGIDELCQPYGSDYRHCISTAINAGIDMVMVPFRYEIFVEELMSLVQSGEIPIARIDD
AVERILRVKFAAELFEFPLTDRSLLDVVGGKLHRDLAHEAVRKSLVLLKNGKDPSKPFLP
LNRNAKRILVAGTHADDIGYQCGGWTGTKYGSSGRITIGTTILDAVKEAVGNETEVIYEQ
CPSTDIIECSEVSFAVVVVGEGPYAECGGDNSELVIPFNGAGIIDLVADKIPTLVILISG
RPLLLEQCLLEKIDALVAAWLPGTEAQGITDVIFGDHDFKGQLPMTWFRRVEQLDQPVGV
SSCEPLFPLGYGLTYDKENLHD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggagagaagcagtttgagaggtacattgcatttacaatacatggattgtctc
tacatgaatcctcaggaatccattgaagcacgtgtgaaacaccttctttctcttatgact
ttgaatgaaaagattggtcaaatgacacaaattgaacgctcagttgctaccccttctgcc
atcaaacacttctccattgggagtgtgttcagtgctccacacaatggacgttttgagaag
gtactgtcatctgattcggctgatatggtggatgggtttcagaagttggcacttgagtct
cggttagccataccaatcatttatggggttgatgctattcatggtaataatagtgtctat
ggtgctactatatttcctcacaatgttggcctaggagctaccagggatcaagatttagtt
caaagaattggagctgcaacatcacttgaactcagagcaagtggaattcactatactttt
gctccttgtgtggcagtatgcaaagatcccagatggggaagatgctatgagagttacagc
gaaaacactgaaatagtcagagagatgacttcttttgttttaggcttgcagggcaatcct
ccagaaagacacccaaggggctacccatttgtggctgggaggaacaatgttgttgcctgt
gccaagcattttgttggagatggaggtacagagaaaggtgtaaatgagggtaataccata
ctatcatatgaagatttggagaggatccacatggccccttacgtggactgcatagctaag
ggagtttctaccatcatggtctcatattccagctggaatggaaacaaactccatggtcac
cattttctgcttaatgaaattttgaaagaaaagctaggcttcaagggatttgtgatttct
gactgggagggaattgatgaattatgccaaccttatgggtcagattatcgtcattgcatc
tccactgccattaatgctggaattgacatggtgatggttccttttagatatgaaatattt
gttgaagagttgatgtctctagttcaatcaggggaaataccaatagcaagaattgatgat
gccgttgagcgcattttgagagtgaagtttgctgctgaactttttgagtttcctttaact
gacagatctttgctagatgtagttggtggcaagctacatagagatctggcacatgaagcg
gttcgaaagtccttggttctgttgaaaaatgggaaggatcctagtaaaccctttcttcca
ttgaacaggaatgctaagagaatccttgttgctggaactcatgctgatgatattgggtat
caatgtggaggatggacaggtaccaagtatggatctagtggccggatcacaatcggcaca
actatcttggatgctgttaaggaagctgtgggaaatgaaacagaagttatttatgagcag
tgtccatcaacagacatcatagaatgtagcgaagtttcctttgccgtagttgtggtcgga
gaaggtccctacgccgagtgtgggggtgacaattcagagcttgtaatcccatttaatgga
gctggaatcatagacttggttgctgataaaatcccaacacttgtgattcttatatctgga
agacctttgctcttagaacagtgcctattggaaaagatagatgctcttgttgctgcatgg
ttgccaggtactgaagcacagggaatcacagatgtcatatttggagatcatgacttcaaa
ggtcaactaccaatgacttggttcagaagagttgaacagcttgatcaaccagttggagtt
agttcatgtgagcccttattccctcttggctatggactaacatatgataaggagaatttg
catgactaa

DBGET integrated database retrieval system