KEGG   Glycine max (soybean): 100800074Help
Entry
100800074         CDS       T01710                                 

Definition
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100800074
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     100800074
    4.2.1.91  arogenate dehydratase
     100800074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 100800074
NCBI-ProteinID: XP_003538142
UniProt: I1LKV9
Position
11
AA seq 428 aa AA seqDB search
MQTLNQPCPNPLNYLTRARHSAIRFAPTRFTVKCGYGFESASFSQGVGASRADWQSSCAI
LASKVVSQREDSPAHGGDNNNNVGAVNGHNAAVTNINLVPVKADDENIKPIPPKPLTISD
LLPAPMHGSQLRVAYQGVPGAYSEAAAGKAYPNGEAIPCDQFEVAFQAVELWIADRAVLP
VENSFGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEFLERVISHPQALAQCE
HSLTKLGLTVAREAVDDTAGAAEFVAKNDLRSTAAIASARAAELYGLQILADGIQDDPNN
VTRFVMLAREPIIPRTDRPFKTSIVFAHDKGTSVLFKVLSAFAFRNISLTKIESRPHRSR
PIRVVDDESEGTAKHFEYLFYIDFEASMAEVRAQNALAEVQEFTSFLRVLGSYPIDMSPW
TPSCPRQN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctcaatcaaccgtgccccaaccctctcaactatctaacccgagcgcgacac
tcggctattcggttcgcgccgacccgattcaccgtcaaatgcggctacggctttgaatcc
gcgagtttctcgcagggagtcggcgcgagccgagccgattggcaaagctcgtgcgccatc
ttagccagtaaagtcgtgtcgcagagggaagattctcccgcccacggcggcgacaacaac
aacaacgtcggcgccgtgaacggccacaacgccgccgtaacgaatataaatctcgtacct
gtcaaagccgatgatgaaaacatcaagccgattccgccgaagccgctcacgatctccgac
ctgttgccggcgccgatgcacggctcgcagctgcgcgtggcgtaccaaggcgttcccggc
gcgtactccgaagccgcggcggggaaagcgtatccgaacggagaggcgattccgtgtgac
cagttcgaggtggcgtttcaagcggtggagctctggatcgcggatcgggcggttttaccg
gtcgaaaactccttcggcggctcgatccaccgcaattacgacctcctcctccgccaccgc
ctccacatcgtcggcgaggtccagctcccagtgcaccactgcctcctcgctctccccggc
gtccgcaaggagttcctcgagcgcgtgatctcacatccgcaggccttagcgcagtgcgag
cactcacttacaaaactcggcctcaccgtggcgcgtgaggccgtcgacgataccgccggc
gctgccgagttcgtcgccaagaacgacctccgctccacggcggcgatcgcgagcgcgcgc
gcggcggagctctacggcctccagatcctggccgacggaatccaggatgatccgaataac
gtgacgcggttcgtgatgctggcgcgcgaaccgatcattccgcgcacggatcggccgttc
aagacgagcatcgtgttcgcgcacgataaaggaacctcagtgctcttcaaagtgctttcc
gcgtttgcgttcagaaacataagcttaacaaagatcgagtccaggcctcaccgtagccgt
ccgattcgcgtggttgatgatgagagtgaaggaaccgcgaagcactttgagtatctgttt
tacattgatttcgaagcttctatggctgaggttagggcacagaacgcactcgctgaggtt
caagaattcacttccttcttgcgagtcttggggagttaccctatcgatatgtcaccctgg
actccctcttgtccgcgccaaaattaa

DBGET integrated database retrieval system