KEGG   Glycine max (soybean): 100800255Help
Entry
100800255         CDS       T01710                                 

Definition
(RefSeq) histone H2B-like
  KO
K11252  histone H2B
Organism
gmx  Glycine max (soybean)
Brite
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100800255
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100800255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone Ureide_permease SOBP CDC45
Motif
Other DBs
NCBI-GeneID: 100800255
NCBI-ProteinID: XP_006591609
Position
11
AA seq 226 aa AA seqDB search
MAHPLSRTCHSLLTPRIYLVPRNLTLGATRQPLESPEDTQTTEEEEVGSQEHVVIIPIQE
VIPQAQKVSPNSDITTENKAEQENNTHQDGGVQNQEEEQKGVVNEEAKEEKNKSKTAKEQ
NGKEKKRGRKKRNIEGYQRYVYGVLKQVHPEMGISSKCMTALNNLMNDMFERLTFEVSKL
TDYTGHMTLSSREIQGVVRLVLPGELEKHAIAEGVKAVNNYTSYDA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcctctctccagaacttgccattcacttttaaccccacgtatttacttggtt
cctaggaatttgacacttggtgccacacgtcaacctctagaatcccctgaagatactcaa
acaactgaggaagaagaagtaggtagccaagagcatgtggtgatcattcccattcaagaa
gtgattcctcaagcacagaaggtttcacctaattctgacatcaccactgaaaacaaagct
gagcaagagaataatactcatcaagatggtggagtccaaaatcaagaggaagagcaaaag
ggagtagtgaatgaggaagccaaagaggagaagaataagagtaagaccgcaaaagagcaa
aatggaaaggagaaaaaaagagggagaaaaaagagaaatattgaagggtaccagaggtat
gtgtatggggtgttgaagcaagtgcaccctgaaatgggaatttcttccaagtgcatgact
gctctgaacaacttgatgaatgacatgtttgagaggctgacttttgaggtttctaagctg
acggactacactggacacatgacattgtcttcaagggagattcaaggagtagtgaggctg
gttctcccaggagagcttgaaaagcatgctattgctgaaggggtcaaagctgttaacaac
tacacatcctatgatgcatga

DBGET integrated database retrieval system