KEGG   Glycine max (soybean): 100800262Help
Entry
100800262         CDS       T01710                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00450  Selenocompound metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100800262
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     100800262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS PrmA Methyltransf_31 Methyltransf_25 Methyltransf_12 Met_10 Methyltransf_32 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 100800262
NCBI-ProteinID: XP_003539379
UniProt: I1LT87
Position
12
AA seq 1090 aa AA seqDB search
MSWMSVDEFLVQCKKSGDAAYASLRSLLDRLDNPETRSQARIFLSHLQKRFPTKDSCDQC
FQTYHFRIEDVSLGQYEGHHGRNKLTMMVIPSIFLPEDWSFTFYEGINRHPDSIFKERTV
AELGCGNGWISIAIAEKWLPSKVYGLDINPRAVKVSWINLYLNALDENGQLIYDEEKKTL
LDRVEFHESDLLSYCREKDIQLERIVGCIPQILNPNPDAMSKMITENASEEFLHSLSNYC
SLQGFVEDQFGLGLIARAVEEGIAVIKPTGIMIFNMGGRPGQGVCKRLFERRGFRITKLW
QTKIIQAGDTDIAALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKSGGSITHALSVY
SCQLRHPNQVKVIFDFLKHGFQEISSSLDLSFEDDSVADEKIPFLAYLASRLKNNSDFPY
EPPAGSKHFRNLIAGFLKTYHHIPLTSDNVVIFPSRTAAIENALRLFSPRLAVVDEHLTR
HLPRQWLTSSALESVGTIDSLDDAMMVIEAPRQSDLMVELIKKLKPKVVVTGIAHFEAVT
SSAFVHLLDATRDIGSRLFLDISDHFELSSLPGSNGVLKYLSGTRLPSHAAIICGLVKNK
VYPDLEVAFVISEEESLFNALSKTVELLEDNTALISQYYYGCIFHELLAFQLAGRHAPAK
RNCENVKSVGMIGFARSASSVLNTAELSIDGVENESLIHMDVDQIFLPVPSPVKAAIFES
FARQNMSESETDVTASIKGFVKSNYGFPTDSSTEFIYADNSKALFNKLVLCCIKEGGTLC
FPAGSNGNYVSSARFLKADIVTVPTNVNVGFKFTEKTLTGVLGTVKNPWVYISGPTVNPT
GLIYSNNEMVEILSTCARFGARVIIDTASSGLEFDCEGWGGWDIEGCLSKLNSSIKPSFC
VTLLGGLSLKMLNGVLRFGFLILNQPVLVDTFYSYPGLSKPHTTVRYATKKLLELKEQKP
SNLSDAIVEQTQILKTRSRCLKEVLEKSGWDVLESCAGVSVVAKPSAYLNKTIKLKISPE
GERSHGNATKEIKLDDSNIRTVILKATGLCINSGSWTGIPGYCRFSIALEENDFKKALDC
IIKFKEVALG
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgagttggatgtcggtggatgagttcctggtgcagtgcaagaagtcaggcgacgctgcc
tacgcctccttgcggtcgcttctggatcgcctagacaatcccgagacccgttctcaggct
cggatcttcctttcccaccttcagaagcgttttcccaccaaggactcctgcgatcaatgc
tttcaaacctaccattttcgcatcgaagatgtttcattgggtcaatacgagggacatcac
ggcagaaacaaattgactatgatggtcattccaagcatttttctacccgaagactggtca
ttcactttttacgaagggattaatagacatccagactccattttcaaggagaggactgtt
gccgagttaggttgcggaaatggatggatttcgattgccattgccgagaagtggttgcca
tccaaggtttatggtcttgatatcaatcctagagcggtcaaggtttcctggataaactta
tacttgaatgctttagatgaaaatggccagctcatctatgacgaggagaagaaaaccttg
ctggacagggtagagttccatgaatctgatcttctatcctattgcagggaaaaagacatt
caacttgaaagaattgttggttgtatacctcagattcttaatccaaatccagatgcaatg
tctaagatgataacagaaaacgcaagcgaggaattcctgcattcattgagtaattattgt
tcacttcagggttttgtggaggaccaatttggcttaggtttaattgctagggcagttgag
gaggggatagcagtaatcaaaccaactggaattatgatctttaacatggggggccgccca
ggtcaaggtgtttgcaaacgattgtttgagcgtcgaggttttcgcattacaaagctttgg
caaactaaaatcattcaggctggtgacacagatattgcagccttagttgagattgagaag
aacagcccacaccgttttgagttttttatgggactttctggagatcagcctatttgtgca
aggaccgcgtgggcttacggaaagtctggtggcagcattacccatgctttatcagtatac
agttgtcaacttcgtcaccctaaccaggttaaagttatatttgattttctaaaacatgga
tttcaagagatcagcagctccctagatttgtcttttgaggacgattctgttgctgatgag
aagattcctttccttgcttatcttgcaagcagactaaaaaataattctgattttccgtat
gagccaccagctggaagcaaacatttccgcaatctcatagcaggatttttgaagacttat
caccatattccactcacttccgataatgttgtcatttttccttcaaggactgcagcaatt
gagaatgctcttcgcttgttttcacctcgccttgcagttgttgatgaacatctgactcga
cacttacctaggcagtggttaacatcttcagcacttgagagcgtaggaactatagactct
ttagatgatgcgatgatggtaattgaagcccctcggcaatcagacttaatggtagaactg
ataaagaaattgaagcctaaagtggtggtgactgggattgctcattttgaggctgttact
agctcagcttttgtgcaccttttagatgcaacacgagacattggatctcgtcttttcttg
gacatatcagatcactttgagctatccagccttcctggatcgaatggggtcttgaagtat
ctttcaggaactcgtctgccctctcatgcagcaattatatgtggactggtaaagaataag
gtttatccggatttagaagtagcttttgtcatttcagaagaagaatccctctttaacgcc
ttgtccaaaactgttgaattactagaagacaatactgcattaattagtcagtactattat
ggctgtattttccatgagcttcttgcttttcagcttgccggccggcatgctcctgccaag
agaaactgtgagaatgtcaaatcagttggtatgataggatttgctagatcagcctcatct
gtccttaatactgctgagttatctattgatggggtagagaatgagtccctaatccacatg
gacgttgatcaaatcttcttgcctgttccatctcctgttaaggcagctatttttgaaagt
tttgccagacaaaatatgtctgaatctgaaactgatgtcacagcaagcatcaaaggattt
gtcaagagtaactatggttttccaacagatagcagcaccgaatttatatatgctgacaat
tcaaaagctcttttcaacaagctggtcctctgctgcatcaaagaaggtggcaccctctgt
tttccagccggatcaaatgggaactatgtttcgtctgccagatttttgaaagctgacata
gtgacagtacctaccaatgtcaatgtaggttttaagttcacggaaaagacactcactgga
gttcttgggactgtgaaaaacccatgggtgtatatttctggtcctacagtcaatccaact
ggcttaatttatagcaacaatgagatggtagaaattttaagcacttgtgctagatttggt
gcaagagttataattgatactgcatcctctggtttagaatttgactgtgaaggctggggt
ggctgggatatagaggggtgtttgtctaagttgaattcttcaatcaagccatcgttctgt
gtgactcttcttggtggactgtctcttaagatgctcaatggtgttctcagatttggcttt
cttattctaaaccagcctgttttggttgacacattttatagttatccaggattaagcaaa
cctcatactactgttagatatgctacaaagaaattgctggaacttaaagagcagaaacca
tcaaacctatcagatgctattgttgaacaaacacagatattgaaaactaggtccaggtgc
ttgaaagaggttcttgagaaaagtgggtgggacgtgcttgaatcgtgtgcgggtgtgtct
gttgtggccaagccctctgcctatctcaacaagactattaagctgaaaatttcacccgaa
ggtgaacgaagccacggaaatgccactaaggaaataaagctcgatgactctaatattagg
actgtcattctcaaagccactggattatgtatcaatagtggttcgtggactggaattcct
ggatactgtcggttcagtattgcactcgaagaaaatgatttcaaaaaagcattggattgc
attataaaatttaaagaagtcgcactgggttaa

DBGET integrated database retrieval system