KEGG   Glycine max (soybean): 100801339Help
Entry
100801339         CDS       T01710                                 

Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    100801339
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100801339
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100801339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 100801339
NCBI-ProteinID: XP_003539740
UniProt: I1LR10
Position
12
AA seq 371 aa AA seqDB search
MAGVNPNGVADFAAVPTHGGQFIQYNIFGNLFEVTTKYRPPIMPIGRGAYGIVCSLLNTE
TNELVAVKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGLRDVIPPPLRREFNDVYIAT
ELMDTDLHHIIRSNQNLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNSNCDLK
IIDFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPLF
PGKDHVHQMRLLTELLGTPTEADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAID
LVDKMLTVDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFDFEQQQLDEEQIKEMIY
REALALNPEYA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccggagttaatccaaacggcgtcgccgattttgcggcggttccgacgcatggcgga
cagttcattcagtacaacatatttggaaacctcttcgaggttacgacgaagtaccgtcct
ccgatcatgcctatcggacgcggcgcgtacggaatcgtttgctcactgttgaataccgag
acgaacgagctggtggctgtgaagaagatagcgaacgctttcgacaatcacatggacgct
aagcgtacgcttcgtgagattaagcttcttaggcatttggatcatgaaaatgtaattggt
ttgagagatgttattcctccacccttgcgtagagagtttaatgatgtctacatagccact
gaactcatggatactgatcttcaccatatcattcgctccaatcaaaatctgtcagaggag
cactgccaatacttcttgtaccagattcttcgtgggcttaagtatatacattctgcaaac
gtaatccatagagatttaaaaccaagcaacctgctgctaaactcaaactgtgatttaaag
attattgattttggtcttgcgagaccgactttggaaagtgacttcatgacagaatatgta
gtcacaagatggtatagagctcccgaattgttgttgaactcctctgattacacctctgct
atagatgtgtggtctgttggttgcatctttatggagcttatgaataaaaagcctctgttt
ccgggcaaagaccatgtgcatcagatgcgcctattgacagagcttcttggcaccccaact
gaggctgaccttgggttagtgaaaaatgaagatgcaagaagatatatcagacaacttcct
caatatcctcgccaacctttagctcaagtcttcccccatgttcatcccgcagccattgat
cttgttgataaaatgctgacagttgatcccaccaaaagaattacagttgaagaagcacta
gcccatccataccttgaaaaactgcatgatgtagctgatgaaccaatctgcatggagcca
ttctcatttgattttgagcaacagcaattggatgaagagcaaataaaagagatgatctac
agggaagcattagcactgaatcctgagtatgcttaa

DBGET integrated database retrieval system