KEGG   Glycine max (soybean): 100801447Help
Entry
100801447         CDS       T01710                                 

Definition
(RefSeq) L-tryptophan--pyruvate aminotransferase 1
  KO
K16903  L-tryptophan---pyruvate aminotransferase [EC:2.6.1.99]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00380  Tryptophan metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100801447
Enzymes [BR:gmx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.99  L-tryptophan---pyruvate aminotransferase
     100801447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alliinase_C Aminotran_1_2 Complex1_51K
Motif
Other DBs
NCBI-GeneID: 100801447
NCBI-ProteinID: XP_003517717
UniProt: I1J558
Position
1
AA seq 391 aa AA seqDB search
MVVATNSFPSSSVTIPPTNISPNAILPLERGDPIVFGEYWKKMSETCTVVIKGWELMSYL
SDMNNVCWYMLPETKEAIKRLHHVVGNAVTEDRYIVVGNGATQLLQGAVFALTPSEASKP
INVVVAAPYYSEYQDEVDILRSGLYQWAGDAALYEKNEPYIEVVTSPNNPDGTMRGPVVK
SEAEGKLIHDLAYYWPHYTPITHQADHDIMIFTFSKCTGHAGSRIGWAIVKDIEVAKKMT
RYVQMSSIGVSKESQTRVAKIMGVICDGYQNFESMESELFFEYSKRILKKRWEKLWEVID
ESKVFSVAKYPKAFCNFTNESSESFPGFIWLKCEEGIEDCGSYLLEKLKIRARGGERFGV
SPKYARISMIGTDDEFHEFLNRVSNAKKECD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggcaacaaacagcttcccttcttccagtgtcacaattcccccaacaaatatc
tcacctaatgccatcctacctcttgagaggggtgatccaatagtgtttggtgaatactgg
aaaaagatgagtgagacttgcaccgtagttatcaaagggtgggagcttatgagctatctg
agtgacatgaacaacgtgtgctggtacatgttaccagagacgaaggaagccattaaaagg
ctccaccacgtggtgggaaatgctgttaccgaagacagatacattgtggtggggaatgga
gccacacaactcctccagggtgctgtttttgctctcactccttcagaggcttctaaaccc
atcaacgttgtggttgctgctccatactactcggaataccaagatgaggttgatattttg
cgttcagggttgtatcaatgggctggtgatgctgctttgtatgagaaaaatgaaccctac
atagaggtggtaacctctccaaacaaccctgatgggactatgaggggtcctgtggtgaaa
tctgaagctgaagggaagctgattcatgatcttgcctattactggccacactacactccc
attactcaccaagctgaccatgatatcatgatcttcacattctccaaatgcactggtcat
gctggttcacgtatagggtgggctatcgtgaaggacattgaggttgctaagaagatgaca
aggtatgtgcagatgagctccattggagtctcaaaagaatcccaaactcgagttgctaag
atcatgggagtgatttgcgatggataccaaaactttgagtccatggagtctgagctcttc
tttgaatatagcaaacgcatcttgaagaagaggtgggagaaattgtgggaagttattgat
gaaagcaaggtcttctctgtggccaagtaccctaaggccttctgcaacttcactaatgag
tcatctgaatcattccctggttttatatggttgaagtgtgaggagggcatagaagattgt
gggagttatctgctggaaaaattgaagattcgtgcaagaggaggagaacgatttggtgtt
agtccaaagtatgctagaattagcatgataggaacggatgatgagttccatgaatttttg
aatagggtgtcgaatgctaaaaaagaatgtgattga

DBGET integrated database retrieval system