KEGG   Glycine max (soybean): 100801805Help
Entry
100801805         CDS       T01710                                 

Definition
(RefSeq) protein IWS1 homolog 1
  KO
K17498  transcription factor SPN1
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gmx03021]
    100801805
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100801805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 baeRF_family3 BRCA-2_helical
Motif
Other DBs
NCBI-GeneID: 100801805
NCBI-ProteinID: XP_003534295
UniProt: I1L519
Position
9
AA seq 508 aa AA seqDB search
MGYEDNPYRDEDGEPLMDYDDVQSDREPSPEPRHQLDDFEEDVDEWRGRDRSQTPVYDTD
PSRSKPRKRLIKKSDAGKQAVEPELEDEDVEGYVPEGVFDEGDAGRKRKKGKEGGSGKKE
KRMKGEKSFGSGGAKSGSKFGSGKKGFGGKAGKDHDGEVKEMWDTIAGGDSEDDQEGLRN
VDDDNFIDDTGVEPAYYGSDEPRSPGDAPQAEEGEEDEEIKDLFKIGKKKKKNERSPAEI
AYLVETVMAELEVTAEEDAELNRQGKPAVNKLKKLNLLTEVLSKKQLQLEFLDHGVLTLL
KNWLEPLPDGSLPNINIRTEVLKILNDFPIDLEQYDRREQLKKSGLGKVIMFLSKSDEEI
NVNRKLAKELVDKWSRPIFNKSTRFEDMRNVEDDRVPYRRPSVKKPANKAAGMESRDSDL
DLELSQPRSGQSSSRQHASRPEATPLDFVVRPQSKIDPEEIRARAKQAAQDQQRMKMNKK
LQQLRAPKKKQLQATKLSVEGRGMIKYL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgaagacaatccgtatcgcgacgaggacggagagcccttgatggactacgac
gacgttcaatccgatcgcgagccatctcccgagcctcgccaccagctcgacgatttcgag
gaggatgtcgacgagtggcgcggccgcgatcggtctcagacgccggtctacgacaccgat
ccgtcgcggtcgaagccgcggaaaaggctgatcaagaagagcgatgccgggaagcaggcg
gtggagccggagcttgaggacgaggacgtggaggggtatgttccggagggggtgttcgac
gagggggacgctgggaggaagaggaagaagggtaaggagggtgggagtgggaagaaggag
aagaggatgaagggagagaagagttttgggagtggcggtgcgaagagtgggtccaaattt
gggagtggaaagaaagggtttggtgggaaggcagggaaggatcatgatggtgaagttaag
gagatgtgggatacaattgctgggggagattctgaggatgatcaagagggtctcaggaat
gtggatgatgacaactttattgatgacactggagtggaacctgcttattatggtagtgat
gaaccacgttctcccggtgatgctccccaggcagaggagggtgaagaggacgaagaaatt
aaggatcttttcaagataggtaagaaaaagaagaagaatgagagaagtcctgcagaaata
gcttatttagttgagactgtcatggctgagcttgaggttacagctgaggaggatgctgaa
cttaatagacaggggaagcctgccgttaataaactcaagaagttgaatcttcttacagaa
gtcctctcaaagaaacagcttcaactggagtttttagatcatggagtgctaactttattg
aagaattggcttgagccacttcctgatggaagcttgccaaatataaatatacgcacagaa
gttttgaagatattgaatgattttcctatagatctagagcagtatgatagaagagaacag
ctgaagaagagtggtcttgggaaggtcattatgtttctatcgaagtctgatgaagaaatc
aatgtgaataggaaactagccaaggagctggttgataagtggagccggcctatatttaat
aagagtacccggtttgaagacatgagaaatgtggaggatgatagggttccttataggaga
ccatcagttaaaaagccggcaaataaagctgcaggaatggaatctagagacagtgatctt
gatttagaactttcacagcctaggtctggacagtcctcttctaggcagcatgcatcaagg
ccggaagcaacacctttggattttgtggtccggccccagtctaaaattgatccagaagaa
attagagcacgagcaaaacaagctgcacaagatcagcagcgtatgaagatgaataagaaa
ttgcagcaattgagggcaccaaaaaagaagcagcttcaggctacaaaattgagcgtggaa
ggtcgtggtatgatcaaatatttataa

DBGET integrated database retrieval system