KEGG   Glycine max (soybean): 100802367Help
Entry
100802367         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100802367 isoform X2
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_10 CBM_4_9
Motif
Other DBs
NCBI-GeneID: 100802367
NCBI-ProteinID: XP_003536575
UniProt: I1LEE1
Position
10
AA seq 581 aa AA seqDB search
MKVAAEGCNLLLLFITSYLSLISGLGVHSLSYDHSATTKCLAEPRRAQYGGGIIVNPGFD
HNIEGWTVFGKGAIKERISNGGNRFIVAHNRTHPLDSFSQKVQLKKGMLYTFSAWLQVSE
GSDTVSVMFKTKGSKMVRGGQVIAKHGCWTLLKGGIAANFSSPVEILFESKNSNAEIWAD
NISLQPFNKKQWRSLQDASIERVRKRKVRFQISHVNETALIGAKVITRPIKLNFPFGCGM
NHHILTNKDYQSWFVSRFKFTTFTNEMKWYSTEKKQGEENYTIADAMLKFTKENGISVRG
HNIFWDNPKLQPEWVKNLSPEKLGEAAAERMKSVVSRYKGELIAWDVMNENLHFHFYEDK
FGENASAAAYATAYELDQEPKLFLNEFNTIEYSGDEASSPAKYIKKLQEILSFPGVSGMS
AAIGLQGHFASGQPNLAYMRSGLDLLATTGLPIWLTEASVDPQPSQAEYLEEILREAYSH
PAVEGIIMFSGPAQAGFNATTLADETFKNTPAGDVVDKLIQEWGTGPNIATADNRGIVDI
SLHHGDYDVTVTHPLIHSPITLNLCVKKDFSLETIHVKMRA
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgctgcagaaggctgcaacttactgttattgttcattacctcttacctttca
ctgatctcagggcttggcgtccattctttgtcttatgatcattctgctaccacaaagtgt
ttggcagaacctcggagagcacagtatggaggaggcattatagtaaatccaggatttgat
cacaacatagagggttggacagtatttggaaaaggagcaatcaaggagcgaatatcgaat
ggaggcaatagattcattgttgctcacaacagaacacatccattggatagtttctctcag
aaggtccaacttaagaaaggaatgctatacaccttttctgcttggcttcaggttagtgaa
ggaagtgacactgtgtcagttatgtttaaaacaaaaggaagcaaaatggtacgaggtggc
caagtgatagcaaagcatggatgctggacccttctaaaaggcggcatagctgctaacttt
tcaagccctgttgaaattctttttgagagcaagaattcaaacgcggaaatatgggctgat
aatatctccttacaaccattcaataaaaagcagtggagatctctacaagacgccagcatt
gagagggtacgtaagaggaaggtgagattccaaataagtcatgtaaacgaaacagcattg
ataggagctaaagtcatcaccagaccaataaagttaaacttcccatttggatgtggaatg
aaccatcatatcctcacaaacaaagactaccagagttggtttgtctcaaggttcaaattc
acaaccttcaccaatgagatgaagtggtatagtacggagaaaaagcaaggcgaggaaaac
tacactatcgcagatgccatgctgaaatttaccaaagagaatggcatttctgtgagaggc
cataacattttctgggacaatccaaaacttcagccggaatgggttaagaatctatcacct
gagaaattaggagaagcagcagctgaaagaatgaaatctgtggtttcaagatacaaagga
gaactgattgcatgggatgtgatgaatgagaatctccacttccacttttacgaggacaaa
ttcggtgaaaatgcctctgcagcagcatatgcaacggcttacgagcttgatcaagagccg
aagttgttcctgaatgagtttaacaccattgagtatagtggggatgaggcttccagccca
gccaaatatataaaaaaacttcaggagattctgtcatttccaggagtttctggaatgtca
gcagcaatagggttgcaaggccatttcgctagtggccagccaaatcttgcttatatgagg
tcaggtcttgatcttcttgctacaactggacttccaatttggctcacagaagcaagtgtg
gatccacaacctagtcaggcagagtacctggaagagatactaagagaggcatactctcat
cctgctgttgaagggattataatgttttctggtccagctcaagctggtttcaacgccacg
actctagccgatgaaactttcaaaaacactccagctggagacgttgtggacaagctgatt
caggagtggggaactgggcctaatattgccacagcagataacagaggaattgtagatatt
tcactgcaccatggagattatgatgtaactgttacacatcctctaatccactcccctata
actctgaatctatgtgtaaagaaagatttttcactggaaaccattcacgtgaaaatgcgg
gcataa

DBGET integrated database retrieval system