KEGG   Glycine max (soybean): 100802661Help
Entry
100802661         CDS       T01710                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100802661
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     100802661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 NAD_binding_8 p25-alpha LysR_substrate DAO DUF1858 BET Cas_Cas1 NAD_binding_7 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 100802661
NCBI-ProteinID: XP_003547132
UniProt: I1MEA0
Position
15
AA seq 576 aa AA seqDB search
MSSITFFQHLSRAFRDNQSHLKLVLLCTAVSGGGLWAYGESVAPEEAVSEKKKVVVLGTG
WAATSFMKNLKNPKYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFKKKVDVQ
FSEAECFKIDAENRKVYCRSSVNNNLNGKEEFVVDYDYLIVAVGANVNTFNTPGVTENCH
FLKEVEDAKKIRRTVIDCFERANLPDVSEDEKKRILHFAIVGGGPTGVEFAASLHDFVNE
DLLRLYPGIKDLVKITLLEAGDHILGMFDKRITTFAEDKFRRDGIDVKTGSMVVKVSEKE
ISTKELKNGGEIKTIPYGMAVWSTGIGTRPFIKDFMAQIGQASRRALATDEWLRVEGCSN
VYALGDCATINQRKVMEDIVAIFKKADKESSGTLTVKQFQEVMKDICERYPQVELYLKNK
QMHNIADLLKEAKGDDKKESIELNIEELKTALSKVDSQMKFLPATAQVASQQGTYLAKCF
NRMEECEKNPEGPLRFRGEGHHRFKPFRYKHLGQFAPLGGEQTAAQLPGDWVSIGHSSQW
LWYSVYASKQVSWRTRALVVSDWTRRFIFGRDSSSI
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtatcactttcttccagcatctctctagagctttccgtgataaccagtcgcat
cttaagcttgtactgctctgcaccgccgtaagtggtggtggtctttgggcttatggtgag
agtgttgccccagaagaggcagttagcgagaagaagaaggtggtggtgctgggaactggt
tgggcggccacaagttttatgaagaatttgaagaatccaaaatatgaggttcaagtagta
tcgcctcgtaactactttgcattcactcctttgctgcctagcgttacgtgcgggaccgtc
gaagcgcgcagcattgttgagccagttcgcaatatttttaagaaaaaggtggacgtacaa
ttcagtgaagcagaatgtttcaagattgatgcagaaaataggaaagtttactgtcgatct
agtgtgaacaataatttgaatgggaaagaagaatttgttgtggattatgactacctaata
gttgcggtgggtgctaatgtcaatacatttaatactccaggagtgacggagaattgccat
ttcttgaaggaagttgaagatgctaaaaaaattagaagaacagttattgactgcttcgag
agagcaaatttgcccgatgtaagtgaagatgagaagaagagaattcttcattttgctatt
gttggaggtggacctactggagtagagtttgcagcctcacttcatgattttgtcaatgag
gatttgctccgtttatatcctgggattaaagatttagttaaaattacacttctggaggcc
ggagatcatatcttgggcatgtttgacaagagaattactacttttgctgaagacaagttt
cgaagagacgggattgatgtgaaaacaggatccatggttgttaaggtatccgagaaagaa
atttccactaaagaactgaaaaacggaggagagattaagacaattccgtatggaatggct
gtctggtcaactggtattggcactcgtccatttattaaagatttcatggcacaaatcggt
caggctagcaggcgtgctctagctacagacgagtggttgagagttgaagggtgcagcaat
gtctatgcgcttggtgactgtgccacgataaaccagcggaaagtcatggaagatatcgtg
gcgatctttaagaaggctgacaaagagagttccggaacacttacggtcaaacaatttcaa
gaggtcatgaaagatatctgtgaaagataccctcaggttgagctatatctgaagaataaa
cagatgcacaacattgctgatttattgaaggaagccaagggagatgataaaaaagaatca
attgaactgaatattgaagaactcaaaactgcactttccaaagtggattctcaaatgaaa
tttcttcctgctacagcacaggttgcatctcagcaaggcacttacctggccaagtgtttt
aatcggatggaagagtgtgaaaaaaatcctgagggtcctctcaggttcaggggagaaggt
caccatcggttcaaaccctttaggtacaagcatttaggtcaatttgctcctttgggagga
gagcagacagctgcccagcttcctggagattgggtttcaattggccatagcagtcaatgg
ctgtggtattctgtctatgcaagcaagcaagtaagctggcgtactagagcgttagtagtt
tcagactggacaagacgttttatttttggaagggactcaagtagcatctga

DBGET integrated database retrieval system