KEGG   Glycine max (soybean): 100802993Help
Entry
100802993         CDS       T01710                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00350  Tyrosine metabolism
gmx00360  Phenylalanine metabolism
gmx00380  Tryptophan metabolism
gmx00950  Isoquinoline alkaloid biosynthesis
gmx00965  Betalain biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100802993
   00360 Phenylalanine metabolism
    100802993
   00380 Tryptophan metabolism
    100802993
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    100802993
   00950 Isoquinoline alkaloid biosynthesis
    100802993
   00965 Betalain biosynthesis
    100802993
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmx04147]
    100802993
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100802993
    4.1.1.105  L-tryptophan decarboxylase
     100802993
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100802993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Aminotran_5 Beta_elim_lyase DUF1148 SepSecS
Motif
Other DBs
NCBI-GeneID: 100802993
NCBI-ProteinID: XP_003529905
UniProt: I1KHY8
Position
7
AA seq 519 aa AA seqDB search
MEMKNTMNRNPQSDAPIIKPLDPEEFKRQGYMMVDFLADYIRNVSHYPVLSKVEPGYLKQ
RLPTSAPCGPEPIESILKDVQDHIIPGLTHWQSPNFYGYFPSSGSIAGFMGEMLSAGLNV
VGFNWVSSPSATELESIVMDWLGQVLNLPKSFLFCGDHGGGVVLGTTCEAILCTLVAARE
KKLSQVGKENIGKLVVYGSDQTHSALQKAAQIAGIHPANFRVIKTKRSNSFALSPDSLLS
TILLDVERGLIPCFLCATVGTTAIATIDPIGPLCNVAKDYGIWVHVDAAYAGSACICPEF
RHCIDGVEEVNSFSLNAHKWFLTNLTCCCLWVKDHIALTKSLTVNPQFLRNKASESKRVI
DYKDWQIPLSRKFNALKLWLVLRSYGVENIRNFLRNHVQMAKTFEGLVRLDKRFEIVVPP
KFSLVCFRIAPSAIIANGLSKGVEACYNGKLVNDEYMVNEVNRKLLDSVNSSGDAFMTHG
EVEGAFMIRCAIGGTLTEEHHVIMAWKLVQEHANSLLGL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaagaatacaatgaataggaaccctcaaagtgatgcaccaatcataaaacct
ctagatcctgaagaattcaagaggcaaggctatatgatggttgatttccttgctgattat
attaggaatgttagccattatcccgttttaagtaaagtagaacctggttatcttaaacaa
agattaccaacttctgctccatgtggtccagaacccattgaatccatacttaaagatgtg
caagatcacatcatccctggcctcacacattggcaaagtcctaatttttatggctacttc
ccttcaagtggtagcatagcagggtttatgggtgagatgctgagcgctggactcaatgtg
gttggattcaactgggtgtcatctccatctgccactgagcttgaaagcatagtcatggat
tggcttggacaagtgctgaacctccccaaaagctttcttttctgtggtgatcatggtggt
ggtgtggtgttggggactacttgtgaggccattttgtgcactttggtggctgcaagggag
aaaaaactttcccaagtcgggaaggagaacataggaaaacttgtggtgtatggctctgat
caaacacacagtgcacttcagaaggcagcacaaattgcaggcatccatccagcgaatttc
cgggtcatcaaaacgaagaggtcgaattcgtttgctctgtctcctgattctcttctctcc
accattcttttggatgtggagagagggttgattccttgtttcctatgtgccactgttggc
actactgcaatagcaaccattgatcctatagggccattgtgtaatgtggccaaggactat
ggaatttgggtccatgttgatgctgcttatgcaggttcagcttgcatttgccctgagttt
agacattgcattgatggggttgaagaggttaactcctttagcctcaatgctcataaatgg
tttttgaccaatttgacatgttgttgcctttgggtgaaagatcacattgccctcacaaaa
tccttgacagtaaatcctcaattcttgaggaacaaagcttctgagtcaaagcgagtgatt
gactacaaggattggcagatacccttgagcaggaaattcaatgccctcaaactatggctt
gttcttagaagctatggtgttgagaacattaggaacttcctgagaaatcatgtgcaaatg
gcgaaaacctttgaagggctagtaaggttggataagaggtttgagattgttgtgccacca
aaattctctttggtttgctttaggatcgccccatcagcaataattgctaatggactttct
aaaggtgttgaagcttgctataatgggaaactggtgaatgatgagtatatggtgaatgaa
gtcaatcgtaaattgcttgattctgttaatagttctggtgatgcattcatgactcatggt
gaggtcgaaggagcttttatgattagatgtgctattggtggaaccttaacagaggaacac
catgtgatcatggcatggaagttggtgcaggagcatgccaattctctgttaggactgtga

DBGET integrated database retrieval system