KEGG   Glycine max (soybean): 100804709Help
Entry
100804709         CDS       T01710                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00970  Aminoacyl-tRNA biosynthesis
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100804709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gmx03029]
    100804709
Enzymes [BR:gmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100804709
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100804709
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100804709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 100804709
NCBI-ProteinID: XP_003556212
UniProt: A0A0R0EL96
Position
20
AA seq 143 aa AA seqDB search
MTSKGLLRGASLTANAVWHRSSFFPKVTVSVHPKLVKFQSFSSTTACSSLPPPDLPRLAK
TAQISLTPNEVEEIAPKIQQVIEWFGQLQGIDLESVEPSIRAETENNLRGNAPETFDHRD
ALIASVPSYEEPYIKVPRVLSMD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaaagggttgctgagaggagcttcgttaactgcaaacgcagtttggcataga
agcagtttcttcccaaaggtaacggttagcgtccaccccaagttggtgaaatttcagagc
ttctcatcaaccaccgcttgctcctctcttccacccccggatttgcctcgtttggcaaaa
actgctcaaatttcacttaccccaaacgaggttgaagaaattgctcccaaaattcaacaa
gttatagaatggtttggacagctgcagggtattgatcttgaaagtgttgaaccctcgatc
agagcagagactgaaaacaatttgcgtggtaatgctcctgaaacatttgaccatagggac
gccttgatcgcttctgtcccgagctatgaggagccttatattaaagttccgagggtctta
agcatggactaa

DBGET integrated database retrieval system