KEGG   Glycine max (soybean): 100804924Help
Entry
100804924         CDS       T01710                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-4
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100804924
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100804924
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100804924
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100804924
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100804924
  Exosomal proteins of colorectal cancer cells
   100804924
  Exosomal proteins of bladder cancer cells
   100804924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_9 Thioredoxin_3 Redoxin
Motif
Other DBs
NCBI-GeneID: 100804924
NCBI-ProteinID: XP_003543464
UniProt: I1M4K9
Position
13
AA seq 558 aa AA seqDB search
MRILVLLSLATLLLFSSFSPTFCDHLADDEDLSFLDEPSAAPEHDHHYGADDSNFGDFED
FEEDDAEAYKQPEVDEKDVVVLKEKNFTDAVKNNRFVMVEFYAPWCGHCQALAPEYAAAA
TELKGEDVILAKVDATEENELAQQYDVQGFPTVHFFVDGIHKPYNGQRTKDAIVTWIRKK
IGPGIYNLTTVEEAQRILTNETKVVLGFLNSLVGPESEELAAASRLEDDVNFYQTVNPDV
AKLFHIDQDVKRPALILIKKEEEKLNHFDGKFEKSAIADFVFSNKLPLVTIFTRESAPSV
FENPIKKQLLLFATSNDSETLVPAFKEAAKSFKGKLIFVYVEMDNEDVGKPVSEYFGISG
NAPKVLGYTGNDDGKKFVLDGEVTTDKIKAFGEDFVEDKLKPFYKSDPVPESNDGDVKIV
VGNNFDEIVLDESKDVLLEIYAPWCGHCQSLEPIYNKLAKHLRNIDSLVIAKMDGTTNEH
PRAKPDGFPTLLFFPAGNKSFDPITVDTDRTVVAFYKFLKKHASIPFKLQKPTSTSESDS
KGSSDAKESQSSDVKDEL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctcgtcctgctctctctcgccacccttctcctcttctcctccttctctccc
accttctgcgaccacctcgccgacgacgaggacctcagcttcctcgacgagccctccgcc
gcgccggagcacgaccaccactacggcgccgatgactccaatttcggcgactttgaggac
ttcgaggaggacgacgcggaggcgtacaagcagcccgaggtggacgagaaggacgtcgtc
gttttgaaggagaagaacttcaccgacgccgtcaagaacaaccgcttcgtcatggtcgag
ttctacgcgccctggtgcggccactgccaggccctcgcgccggagtacgccgccgccgcg
acggaactcaagggcgaagacgtaattttggcaaaggtggatgccaccgaggagaatgaa
ttggcgcagcagtacgatgttcagggtttccccactgtccacttcttcgttgatggcatt
cacaagccttataatggccaaaggaccaaagatgctatagtgacgtggattaggaagaag
atcggacctggcatatacaacttgactacagtggaggaggctcaacgcattttgaccaac
gaaactaaagttgttttgggcttcctcaactctttagttggtcctgagagtgaggagctt
gctgctgcttcaaggcttgaggatgatgtcaatttttatcaaactgtgaatcctgatgtg
gcaaagcttttccatattgaccaagatgttaagcgtccagcattgatcctcattaagaaa
gaggaggaaaaacttaaccactttgatggaaaattcgagaagtcagcaatagcggacttt
gtcttctccaacaagcttcctttggtaacaatttttacaagagaaagtgccccatcagtc
tttgaaaatccaatcaagaaacagttgttgctgtttgcaacttcaaatgattcagagact
ttggtcccagcatttaaagaagcagcaaagtctttcaagggaaagttgatctttgtatat
gtggaaatggataacgaagatgttggaaagcctgtttcagaatactttggtatcagtggg
aatgctccaaaagtacttggatacactgggaatgatgatggaaaaaaatttgtgcttgat
ggagaggtgactactgacaaaattaaggcatttggggaagatttcgttgaagacaagcta
aaacctttttacaagtcagatccagttcctgaaagtaatgatggtgatgtgaaaatagta
gttggtaataattttgatgaaattgtcttggatgagtcaaaggatgttctcctcgagatt
tatgctccctggtgtggccattgccaatcactggagccaatatacaacaagcttgcaaaa
catcttcgcaatattgattctcttgtaatagccaagatggatggaacaacaaatgagcat
cccagggctaagcctgatggattccccactcttctcttcttcccggcaggaaacaagagt
tttgaccctattactgttgatacagatcgtacagtggtagccttctacaagttcctcaag
aaacatgcatcaatcccattcaagctccagaaaccaacctcaacttctgaatccgattcc
aaggggagctctgatgccaaagagagccagagtagtgatgtgaaggacgaattatga

DBGET integrated database retrieval system