KEGG   Glycine max (soybean): 100805303Help
Entry
100805303         CDS       T01710                                 

Definition
(RefSeq) threonine synthase, chloroplastic
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00260  Glycine, serine and threonine metabolism
gmx00750  Vitamin B6 metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100805303
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100805303
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     100805303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 100805303
NCBI-ProteinID: XP_003546745
UniProt: I1MD26
Position
15
AA seq 519 aa AA seqDB search
MASSSLFQSLPFSLQTSKPYAPPKPAAHFVVRAQSPLTQNNNSSSKHRRPADENIRDEAR
RINAPHDHHLFSAKYVPFNADSSSSSSTESYSLDEIVYRSQSGGLLDVQHDMDALKRFDG
EYWRNLFDSRVGKTTWPYGSGVWSKKEWVLPEIHDDDIVSAFEGNSNLFWAERFGKQFLG
MNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNRPVVGVGCASTGDTSAALSAYCAS
AAIPSIVFLPANKISLAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAELPIYLANSLNS
LRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDKIPRLVCA
QAANADPLYLYFKSGWKEFKPVKSSTTFASAIQIGDPVSIDRAVHALKSCDGIVEEATEE
ELMDATAQADSTGMFICPHTGVALTALFKLRNSGVIKATDRTVVVSTAHGLKFTQSKIDY
HSKDIKDMACRYANPPMQVKADFGSVMDVLKTYLQSKAH
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttctctgtttcagtctctccctttctctctccaaacctctaaaccctac
gcgcctcccaaacccgccgcccacttcgttgtccgcgcccaatcccccctcactcagaac
aacaactcctcctccaagcatcgccgccccgccgacgagaacatccgcgacgaggcccgc
cgcatcaatgcgccccacgaccaccacctcttctcggccaagtacgtccccttcaacgcc
gactcctcctcctcctcctccacggagtcctactcgctcgacgagatcgtctaccgctcc
caatccggcggcctcctggacgtccagcacgacatggatgccctcaagcgtttcgacggc
gagtactggcgcaacctcttcgactcgcgcgtgggcaaaaccacctggccttacggctcc
ggcgtctggagcaaaaaagaatgggtcctccccgagatccacgacgacgatatcgtctcc
gccttcgagggtaactccaacctcttctgggccgagcgtttcggcaaacagttcctcggc
atgaacgatttgtgggtcaaacactgcggaatcagccacaccggcagcttcaaggatctc
ggcatgaccgtcctcgtcagccaggtcaatcgcttgagaaaaatgaaccgccccgtcgtc
ggtgttggttgcgcctccaccggtgacacatcggccgctttatccgcctattgcgcttcc
gctgccattccttccattgtgtttttgcctgctaataaaatctctcttgcccaacttgtt
cagcctattgccaatggagcctttgtgttgagtatcgacactgattttgatggttgcatg
cagttgatcagagaggtcactgctgagttgcctatttatttggctaactctctcaacagt
ttgaggttggaagggcagaagactgctgctattgagattctgcagcagtttgattggcag
gttcctgattgggtcattgtgcctggaggcaaccttggcaacatttatgccttttacaaa
gggtttaagatgtgtcaagagcttgggcttgtggataagattccaaggcttgtttgtgct
caggctgccaatgctgatcctttgtatttgtactttaaatccgggtggaaggagtttaag
cctgtgaagtcgagcactacatttgcctctgccattcaaattggtgatcctgtttccatt
gacagggcggttcacgcgctaaagagttgcgatgggattgtggaggaggccacggaggag
gagttgatggatgctacagcgcaggcggattctactgggatgtttatttgcccccacacc
ggggttgctttaactgcattgtttaagctcaggaacagcggggttattaaggccactgat
aggactgtggtggttagcactgctcatggcttgaagttcactcagtccaagattgattac
cattctaaggacatcaaggacatggcttgccgctatgctaacccgcccatgcaagtgaag
gcagactttggctcggttatggatgttttgaagacgtatttgcagagtaaggctcattag

DBGET integrated database retrieval system